LL-37 Certificate of Analysis (COA) Standards

High-purity LL-37 requires rigorous analytical verification before deployment in preclinical research environments. A comprehensive Certificate of Analysis (COA) provides critical quantitative data on peptide sequence identity, chromatographic purity, and contaminant thresholds. PX1 Research delivers lot-specific third-party COAs generated by accredited ISO 17025 testing facilities to ensure reproducible experimental outcomes.

GMP-compliant U.S. facilities
ISO 17025 third-party COAs
100% domestic — no imports
Fast tracked domestic shipping
Shop research peptides

Quick answer

High-purity LL-37 requires rigorous analytical verification before deployment in preclinical research environments. A comprehensive Certificate of Analysis (COA) provides critical quantitative data on peptide sequence identity, chromatographic purity, and contaminant thresholds. PX1 Research delivers lot-specific third-party COAs generated by accredited ISO 17025 testing facilities to ensure reproducible experimental outcomes.

Reviewed by PX1 Research scientific team

Key takeaways

  • A [Certificate of Analysis](/research-peptides/what-is-a-coa-for-peptides) (COA) serves as the primary document verifying the chemical integrity, identity, and purity of a synthesized research peptide.
  • Reversed-Phase High-Performance Liquid Chromatography (RP-HPLC) is the gold standard method for determining the chromatographic purity of synthetic peptides.
  • While HPLC confirms the relative abundance of the primary compound, Mass Spectrometry (MS) establishes the precise identity and molecular weight of the peptide.
  • Endotoxins, specifically lipopolysaccharides (LPS) derived from Gram-negative bacterial outer membranes, represent a significant confounding variable in cellular biology and immunomodulation research.

Anatomy of a Validated LL-37 Certificate of Analysis

A Certificate of Analysis (COA) serves as the primary document verifying the chemical integrity, identity, and purity of a synthesized research peptide. For complex host-defense peptides such as LL-37—a 37-amino acid amphipathic peptide derived from the C-terminal domain of human cathelicidin (CAP-18)— analytical verification is essential. Because synthesized cathelicidins can form secondary structures or undergo truncated sequence accumulation during solid-phase peptide synthesis (SPPS), a superficial inspection is insufficient for cell culture or in vitro screening protocols.

A legitimate ll-37 coa must detail specific quantitative parameters rather than generic pass/fail statements. Investigators evaluating an analytical report should expect line-item metrics detailing High-Performance Liquid Chromatography (HPLC) purity, Mass Spectrometry (MS) mass validation, Limulus Amebocyte Lysate (LAL) endotoxin quantification, visual appearance, and moisture content. Accessing transparent, lot-specific analytical documentation via a verified peptide purity analysis standards protocol protects experimental models from baseline interference caused by residual synthesis byproducts.

High-Performance Liquid Chromatography (HPLC) Purity Testing for LL-37

Reversed-Phase High-Performance Liquid Chromatography (RP-HPLC) is the gold standard method for determining the chromatographic purity of synthetic peptides. During RP-HPLC, the LL-37 sample is passed through a non-polar stationary phase column (typically C18 or C4) under a gradient of polar and organic mobile phases (such as water and acetonitrile containing 0.1% trifluoroacetic acid). Compounds separate based on hydrophobic interactions, generating a distinct chromatogram measured at UV wavelengths of 214 nm or 220 nm, which correspond to peptide bond absorption.

When examining an ll-37 coa, the primary metric evaluated is the relative peak area percentage of the main target peptide compared to total integrated peak area. Research-grade LL-37 supplied by PX1 Research maintains a certified purity threshold of ≥98.0%. Minor secondary peaks in the chromatogram represent deletion sequences (missing one or more amino acids during coupling), diastereomers, or oxidation products generated during cleavage. A baseline-resolved chromatographic profile with minimal fronting or tailing ensures that experimental observations in host-pathogen interaction models or cell viability assays can be attributed strictly to the full-length LL-37 sequence.

Mass Spectrometry (MS) Identity Confirmation for LL-37

While HPLC confirms the relative abundance of the primary compound, Mass Spectrometry (MS) establishes the precise identity and molecular weight of the peptide. Given LL-37's molecular formula of C178H321N61O48 and theoretical monoisotopic mass of approximately 4493.3 Da, high-resolution electrospray ionization mass spectrometry (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF) is utilized to generate a definitive spectrum.

On a certified ll-37 coa, the mass spectrum section displays multicharged species typical of cationic peptides analyzed via ESI-MS. Common mass-to-charge (m/z) signals observed include [M+4H]4+ at ~1124.3, [M+5H]5+ at ~899.7, and [M+6H]6+ at ~750.0. The analytical laboratory deconvolutes these observed charge states to yield an experimental mass that must match the theoretical molecular weight within a strict tolerance (typically ±1.0 Da). This mass verification step guarantees that the peptide batch contains the exact 37-residue sequence ([LL-37, 37 aa]) without silent deletions or adduct formation.

Endotoxin Quantitation and Limulus Amebocyte Lysate (LAL) Assays

Endotoxins, specifically lipopolysaccharides (LPS) derived from Gram-negative bacterial outer membranes, represent a significant confounding variable in cellular biology and immunomodulation research. Because host-defense peptides like LL-37 are frequently studied for their ability to bind LPS or modulate toll-like receptor (TLR) signaling, background endotoxin contamination can obscure experimental outcomes or induce non-specific inflammatory responses in vitro.

PX1 Research subjects every batch of LL-37 to quantitative chromogenic LAL or recombinant Factor C testing. A compliant ll-37 coa specifies the endotoxin burden in Endotoxin Units per milligram (EU/mg). For sensitive cell culture protocols, macrophage activation studies, and organoid assays, endotoxin levels should remain strictly below designated research limits (typically <0.1 EU/mg or <0.5 EU/mg depending on lot specification). Documenting low background endotoxins prevents false positives in assays evaluating innate immune pathway activation.

Physical Characteristics: Lyophilized Cake Appearance and Solubility

A rigorous COA records physical quality control parameters alongside instrumental spectra. The physical appearance of the lyophilized material offers immediate insight into processing quality and cake stability. High-purity LL-37 is typically supplied as a uniform, off-white to white lyophilized powder or cake within sealed glass vials.

Cake structure indicates successful freeze-drying parameter optimization, minimizing residual moisture and maintaining long-term stability. The COA details visual state, solubility characteristics upon reconstitution in sterile water or buffered aqueous media (such as phosphate-buffered saline, pH 7.4), and solution clarity. A clear, particulate-free solution upon reconstitution demonstrates absence of insoluble aggregates or unreacted hydrophobic residues.

Counterion and Moisture Analysis in Cathelicidin Peptides

Synthetic peptides generated via solid-phase synthesis retain counterions paired with basic amino acid residues (lysine, arginine, histidine). In standard reverse-phase purification, trifluoroacetic acid (TFA) is employed, resulting in peptide TFA salts. Because LL-37 contains 11 basic residues (5 arginine, 6 lysine), residual TFA content can represent a notable percentage of total dry weight if not systematically monitored.

A comprehensive ll-37 coa details counterion presence or confirms salt-exchange parameters (such as conversion to acetate or hydrochloride forms when requested for specific cell culture protocols). Additionally, Karl Fischer titration or thermogravimetric analysis measures residual moisture percentage (typically target <5.0%). Distinguishing between pure peptide content (net peptide content) and total dry mass (inclusive of counterions and bound water) allows researchers to calculate exact molar concentrations in quantitative laboratory assays.

Comparative Analysis: LL-37 vs. Other Host-Defense Research Peptides

When designing host-defense and antimicrobial signaling experiments, laboratory personnel frequently evaluate LL-37 alongside alternative peptide classes. Understanding structural, mass, and analytical differences across these compounds is essential for accurate COA interpretation and experimental design.

Unlike short-chain tissue repair peptides such as BPC-157 (a 15-amino acid pentadecapeptide) or extracellular matrix regulators like GHK-Cu, cathelicidins possess an amphipathic alpha-helical domain designed to interact with phospholipid membranes. When compared to mouse cathelicidin-related antimicrobial peptide (CRAMP), human LL-37 shares functional homology but exhibits distinct HPLC retention times and a higher mass. Similarly, comparing LL-37 against human beta-defensin 2 highlights differences in tertiary structure; defensins feature intricate disulfide bonding patterns requiring oxidized fold analysis on their respective COAs, whereas linear cathelicidins rely predominantly on primary sequence purity and charge confirmation. Researchers reviewing the PX1 research library can compare lot specifications across these distinct peptide families.

Sourcing Standards and ISO 17025 Analytical Verification

The integrity of preclinical investigation depends directly on the reliability of chemical inputs. Substandard synthesis, unverified overseas re-packing, or missing lot traceability compromise research reproducibility. PX1 Research mandates that all synthesis processes adhere to strict Good Manufacturing Practice (GMP) compliant facility protocols with final quality verification performed by independent ISO 17025 accredited laboratories.

Every vial of LL-37 distributed by PX1 Research is synthesized in the USA and accompanied by a downloadable, lot-traceable COA. Institutional laboratories and academic facilities establishing institutional bulk accounts gain direct access to raw raw data files, full-spectrum MS readouts, and high-resolution HPLC chromatograms. All inventory is managed across specialized distribution hubs in California and Arizona, enabling same-day dispatch (Monday through Friday) to support uninterrupted laboratory schedules.

Reconstitution Protocols and Storage Guidelines for Laboratory Evaluation

To preserve the analytical purity documented on the ll-37 coa, researchers must follow standardized handling and reconstitution protocols upon receipt. Lyophilized peptides should be stored at -20°C or -80°C in a desiccated environment to prevent premature moisture absorption and enzymatic degradation.

Reconstitution should be performed using sterile, endotoxin-free water or low-salt aqueous buffers. Because cationic cathelicidins can adsorb non-specifically to standard glass or polypropylene container surfaces at low concentrations, investigators often utilize low-binding microcentrifuge tubes or add low concentrations of carrier proteins (such as 0.1% BSA) if compatible with downstream assays. Concentrated stock solutions should be aliquoted into single-use volumes and stored at -80°C to eliminate repeated freeze-thaw cycles that disrupt peptide secondary structure.

Frequently Asked Questions

What primary metrics should I check on an LL-37 COA before starting an experiment?

Key parameters include HPLC purity percentage (should be ≥98%), Mass Spectrometry observed mass matching the theoretical molecular weight (~4493.3 Da), endotoxin quantification (EU/mg), physical lyophilized cake appearance, and moisture content.

What is the theoretical molecular weight of LL-37 shown on the COA?

The theoretical monoisotopic mass of full-length human LL-37 (37 amino acids) is approximately 4493.3 Da (molecular formula C178H321N61O48). ESI-MS reports multicharged m/z species that deconvolute to this target weight.

Why is endotoxin testing critical on a Certificate of Analysis for LL-37?

LL-37 is frequently used in cell culture and immunological research. High baseline endotoxin (LPS) levels cause non-specific TLR activation and cytokine release, masking the intrinsic activity of the peptide in cell-based assays.

How does net peptide content differ from total dry weight on a COA?

Total dry weight includes the peptide along with residual water and counterions (such as TFA or acetate). Net peptide content measures the actual percentage of pure peptide weight within the dry powder, allowing researchers to calculate exact molarities.

Are PX1 Research peptides synthesized in the USA?

Yes. All PX1 Research peptides, including LL-37, are USA-synthesized and subjected to lot-specific third-party testing at accredited ISO 17025 laboratory facilities.

What counterion is present in standard LL-37 preparations?

Standard reverse-phase HPLC purification utilizes trifluoroacetic acid, resulting in TFA counterions attached to basic residues (lysine and arginine). Acetate salt conversion is available for sensitive cellular models upon request.

How should reconstituted LL-37 stock solutions be stored in the lab?

Reconstituted stock solutions should be divided into single-use aliquots in low-binding polypropylene tubes and stored at -80°C. Avoid repeated freeze-thaw cycles to prevent structural degradation.

Can I request raw HPLC chromatograms and mass spectra for my order?

Yes. PX1 Research provides complete, lot-specific COAs including full HPLC chromatograms and deconvoluted mass spectra accessible for every batch delivered.

All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.