The term 157+37 refers to the concurrent or comparative laboratory evaluation of two distinct research compounds: BPC-157, a synthetic pentadecapeptide derived from gastric juice, and LL-37, a 37-amino-acid human cathelicidin antimicrobial peptide. In preclinical literature, researchers analyze 157+37 protocols to determine how angiogenic tissue repair mechanisms interact with innate antimicrobial signaling and host-defense epithelial remodeling in experimental models.
The term 157+37 refers to the concurrent or comparative laboratory evaluation of two distinct research compounds: BPC-157, a synthetic pentadecapeptide derived from gastric juice, and LL-37, a 37-amino-acid human cathelicidin antimicrobial peptide. In preclinical literature, researchers analyze 157+37 protocols to determine how angiogenic tissue repair mechanisms interact with innate antimicrobial signaling and host-defense epithelial remodeling in experimental models.
In modern biochemical research, the 157+37 designation represents an emerging dual-peptide framework designed to investigate synergistic biological responses in complex tissue injury models. While BPC-157 acts predominantly as a cytoprotective and pro-angiogenic signal that accelerates structural tissue regeneration, LL-37 functions as an endogenous host defense peptide capable of neutralizing bacterial endotoxins, modulating broad immune responses, and inducing re-epithelialization.
When evaluated together in preclinical protocols, 157+37 assays allow investigators to probe both the structural restorative cascades and the immunological defense mechanisms necessary for resolving severe tissue trauma. Understanding the distinct structural features, receptor affinity profiles, and signaling dynamics of each compound is essential for designing rigorous in vitro and animal models.
BPC-157 is a synthetic 15-amino-acid peptide (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from a body protection compound isolated from human gastric juice. It possesses exceptional enzymatic stability due to its cyclic-like confirmation in solution and lack of easily cleaved enzymatic motifs, remaining stable in human gastric fluid assays for extended periods compared to native peptides.
Preclinical studies indicate that BPC-157 accelerates the repair of tendon, ligament, skeletal muscle, and gastrointestinal mucosal lining primarily through the upregulation of vascular endothelial growth factor receptor 2 (VEGFR2) and activation of the focal adhesion kinase (FAK)-paxillin pathway. In rodent wound models, administration of BPC-157 promotes rapid capillary sprouting (angiogenesis), enhances cell migration to injury sites, and increases collagen type I deposition without demonstrating cytotoxic side effects in cell culture assays. For further details on native tissue expression, consult our BPC-157 research overview.
LL-37 is the sole human member of the cathelicidin family of antimicrobial peptides (AMPs), generated via proteolysis from the CAP-18 precursor protein. Structurally, LL-37 is a 37-amino-acid amphipathic alpha-helical peptide ([LL-37, 37 aa]) that carries a net positive charge (+6 at physiological pH), allowing it to bind preferentially to negatively charged bacterial membranes and lipopolysaccharides (LPS).
Beyond its direct membrane-disrupting bactericidal activity against Gram-positive and Gram-negative pathogens, LL-37 binds to Formyl Peptide Receptor-Like 1 (FPRL1/FPR2) and epidermal growth factor receptor (EGFR). In vitro assays demonstrate that LL-37 recruits neutrophils, monocytes, and T-cells to sites of infection while stimulating endothelial cell proliferation and re-epithelialization. Its dual role as a microbial neutralizer and tissue-remodeling agent makes it a critical counterpoint to BPC-157 in comparative wound healing research. Additional findings are available in our antimicrobial peptides catalog.
While both agents contribute to tissue recovery in preclinical models, their biochemical targets and modes of action are fundamentally distinct. BPC-157 operates primarily via nitric oxide (NO) pathway modulation, growth factor receptor recruitment, and extracellular matrix (ECM) reorganization. It exerts cytoprotective effects directly on vascular endothelial cells, fibroblasts, and smooth muscle tissues without possessing direct bactericidal properties.
In contrast, LL-37 exerts direct antimicrobial defense via electrostatic membrane destabilization while simultaneously fine-tuning the inflammatory response through chemokine receptor activation. While BPC-157 promotes rapid revascularization within ischemic or damaged tissues, LL-37 prepares the local microenvironment by reducing microbial burden and regulating pro-inflammatory cytokine secretion (such as TNF-alpha and IL-6). The 157+37 framework integrates these complementary axes—vascular/structural restoration versus immunological clearance—providing researchers with a comprehensive model for severe tissue damage research.
Investigating 157+37 co-administration protocols allows laboratories to test hypotheses regarding infected or compromised wound environments. In preclinical models of chronic wound healing—such as diabetic ulcers or contaminated surgical incisions—tissue regeneration is frequently stalled by persistent bacterial colonization and inadequate vascular supply. In vitro data suggest that applying LL-37 neutralizes local endotoxin concentrations and suppresses destructive matrix metalloproteinases (MMPs), establishing a sterile field.
Concurrently, BPC-157 stimulates fibroblast migration, collagen synthesis, and VEGFR2 phosphorylation, allowing for rapid formation of functional granulation tissue. Animal studies assessing combined administration report accelerated wound closure rates, increased microvascular density, and superior tensile strength in regenerated dermal tissue compared to single-agent controls. Laboratories interested in expanding dual-peptide research models can review relevant studies in our PX1 Research Library.
To properly contextualize the 157+37 pairing within tissue repair research, investigators must evaluate how these molecules compare to other established peptides in the same biological categories. For structural regeneration and cell motility, TB-500 (Thymosin Beta-4 active fragment) is frequently evaluated alongside BPC-157 due to its actin-sequestering properties and systemic cell migration activity. For anti-inflammatory and mucosal integrity assays, KPV (an alpha-MSH derivative) provides targeted suppression of NF-kB activity without the broad amphipathic membrane effects of LL-37. Additionally, GHK-Cu serves as a gold-standard copper peptide for remodeling extracellular matrix components and stimulating glycosaminoglycan synthesis.
Comparing 157+37 to alternative combinations—such as TB-500 with KPV—reveals key differences in research utility. While TB-500 focuses heavily on cytoskeletal assembly and KPV on nuclear cytokine inhibition, the 157+37 pair uniquely couples direct growth factor receptor signaling (BPC-157) with cationic amphipathic membrane disruption (LL-37), making 157+37 the preferred experimental model for dirty or septic wound healing assays.
Precision in peptide research requires uncompromising compound purity and detailed analytical verification. Synthetic peptides used in comparative or combined assays like 157+37 must be free of truncated sequence contaminants, TFA salts, and bacterial endotoxins that could skew cellular responses or invalidate in vitro bioassays. PX1 Research enforces strict quality control parameters across every batch of synthesized peptides.
Every lot of BPC-157 and LL-37 supplied by PX1 Research undergoes rigorous testing, including Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) to confirm peptide purity of ≥98.0%, and Electrospray Ionization Mass Spectrometry (ESI-MS) to verify exact molecular mass. Furthermore, all lots are subjected to Limulus Amebocyte Lysate (LAL) testing to guarantee endotoxin levels remain strictly below <0.5 EU/mg. Every order includes a lot-specific Certificate of Analysis (COA) issued by an independent ISO 17025 accredited laboratory.
Proper reconstitution and storage procedures are critical to maintaining the structural integrity of BPC-157 and LL-37 in laboratory environments. Because LL-37 is an amphipathic peptide susceptible to self-aggregation at high concentrations or neutral pH, specific reconstitution solvents and handling practices must be observed during assay preparation.
Lyophilized BPC-157 and LL-37 vials should be stored at -20°C or -80°C for long-term stability. For reconstitution, use sterile bacteriostatic water or sterile standard saline (0.9% NaCl). When working with LL-37, researchers often utilize low-binding polypropylene tubes to prevent peptide adsorption to glass or standard plastic surfaces. Avoid vigorous vortexing; gently swirl the vial until the lyophilized cake is fully dissolved. Reconstituted solutions should be aliquoted and stored at -20°C to prevent freeze-thaw degradation. For bulk experimental protocols, institutions can explore our options through wholesale lab accounts.
Acquiring high-purity research compounds with consistent lot-to-lot uniformity is essential for reproducible scientific data. PX1 Research manufactures all compounds within state-of-the-art, GMP-compliant facilities based in the United States, adhering to strict quality management systems throughout synthesis, purification, and lyophilization.
To support active laboratory schedules, PX1 Research provides same-day shipping for all orders placed before 3:00 PM EST, shipping directly from distribution hubs in California and Arizona. With full lot traceability, verified COAs, and dedicated institutional support, PX1 Research remains the trusted supply partner for advanced peptide research across North America.
What does 157+37 refer to in peptide research?
In research settings, 157+37 refers to the combined or comparative study of BPC-157 (a synthetic pentadecapeptide targeting tissue repair and angiogenesis) and LL-37 (a human cathelicidin antimicrobial peptide targeting innate immunity and host defense). Researchers evaluate 157+37 to analyze combined regenerative and antimicrobial signaling pathways.
How do BPC-157 and LL-37 differ in their mechanism of action?
BPC-157 acts primarily by upregulating VEGFR2 expression, activating FAK-paxillin pathways, and promoting cell migration and angiogenesis for structural tissue repair. LL-37 is an amphipathic cationic peptide that neutralizes bacterial endotoxins (LPS), destabilizes microbial membranes, and recruits immune cells via FPR2 receptor activation.
Can BPC-157 and LL-37 be co-reconstituted in the same vial for laboratory assays?
Co-reconstitution in a single vial is generally not recommended due to potential peptide-peptide interactions, differences in solubility profiles, and varying aggregation behaviors. Researchers typically reconstitute BPC-157 and LL-37 in separate vials using sterile bacteriostatic water before adding them to experimental media at designated concentrations.
What purity levels are required for 157+37 research compounds?
High-validity in vitro and animal models require a minimum peptide purity of ≥98.0%. PX1 Research verifies compound purity using RP-HPLC and confirms exact molecular mass via ESI-MS mass spectrometry for every lot of BPC-157 and LL-37.
Why is endotoxin testing critical when evaluating 157+37 in cell culture?
Bacterial endotoxins (LPS) trigger strong inflammatory cascades in cell culture, which can distort experimental data regarding immune modulation and tissue repair. PX1 Research subjects all peptide lots to LAL endotoxin testing to guarantee levels remain below <0.5 EU/mg.
How should lyophilized BPC-157 and LL-37 be stored in the lab?
Lyophilized vials of BPC-157 and LL-37 should be stored at -20°C for short-to-medium term storage, or -80°C for long-term stability. Vials should be protected from light and moisture desiccation until reconstitution.
How does LL-37 compare to other antimicrobial research peptides like KPV?
LL-37 is a 37-amino-acid cathelicidin peptide with direct bactericidal membrane disruption and broad chemotactic activity. KPV is a tripeptide derived from alpha-MSH that acts primarily as an intracellular anti-inflammatory signal suppressing NF-kB pathways without direct bactericidal membrane pore formation.
What shipping options and fulfillment speeds are available for 157+37 orders?
PX1 Research dispatches research orders same-day Monday through Friday for orders placed before 3:00 PM EST. Shipments originate from strategic fulfillment centers in California and Arizona to minimize transit times for domestic research institutions.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.