Buy GLP-2 for Laboratory Research

Sourcing Research-Grade GLP-2: Direct Sourcing and Quality Benchmarks

Qualified investigators looking to buy GLP-2 require reference-grade materials manufactured under stringent quality management systems. Glucagon-Like Peptide-2 (GLP-2) is a 33-amino acid nutrient-responsive gastrointestinal peptide derived from proglucagon cleavage. In laboratory settings, experimental integrity relies on sourcing reagents that are free from residual truncated sequences, counter-ion contamination, and micro-organism impurities.

PX1 Research provides laboratory-grade GLP-2 synthesized in GMP-compliant facilities within the United States. Every lot is subjected to rigorous analytical validation prior to distribution, ensuring that researchers in academia, biotechnology, and institutional laboratories receive fully characterized compounds tailored for cellular and biochemical assays. Exploring our complete catalog of research peptides provides access to fully documented compounds designed strictly for non-human scientific inquiry.

GLP-2 Structure, Receptor Binding, and Biochemical Mechanism

GLP-2 is co-secreted alongside GLP-1 from enteroendocrine L-cells in the distal ileum and colon following nutrient ingestion. Structurally, human GLP-2 consists of the primary sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD. Its primary biological signal is mediated through the Glucagon-Like Peptide-2 Receptor (GLP-2R), a G-protein-coupled receptor (GPCR) predominantly expressed on subepithelial myofibroblasts, enteric neurons, and specific enteroendocrine subpopulations.

Preclinical binding studies indicate that GLP-2R activation initiates a Gαs-coupled intracellular cascade, elevating intracellular cyclic adenosine monophosphate (cAMP) and activating protein kinase A (PKA). This signaling path regulates downstream gene expression responsible for intestinal epithelial brush-border enzyme activity, hexose transport expression, and localized tissue perfusion. Researchers examining gastrointestinal physiology utilize GLP-2 to dissect non-cell-autonomous pathways, as GLP-2R expression is sparse on crypt progenitor cells directly, operating instead via paracrine mediators such as insulin-like growth factor-1 (IGF-1) and vascular endothelial growth factor (VEGF).

Preclinical Literature and In Vitro Research Applications

In preclinical rodent models, administration of GLP-2 analogs has demonstrated notable trophic effects on small and large intestinal mucosa. Literature highlights significant increases in mucosal weight, villus height, and crypt cell proliferation index following sustained receptor stimulation. In vitro assays employing intestinal organoid platforms indicate that GLP-2-induced paracrine signaling enhances mucosal barrier integrity by upregulating tight junction protein expression, including claudin-1, occludin, and zonula occludens-1 (ZO-1).

Furthermore, animal models of intestinal ischemia-reperfusion and chemotherapy-induced mucositis demonstrate that GLP-2 signaling suppresses crypt stem cell apoptosis and dampens localized pro-inflammatory cytokine expression (TNF-α, IL-1β). Investigators utilizing GLP-2 in preclinical trials also focus on its role in slowing gastric emptying, inhibiting sham-feeding-stimulated gastric acid secretion, and modulating superior mesenteric artery blood flow. Data collected across these models serve to clarify the metabolic and structural adaptations of the gut mucosal architecture.

Comparative Analysis: GLP-2 and Related Incretin/Proglucagon Peptides

To contextualize GLP-2 within gastrointestinal endocrinology, researchers frequently compare its activity against other proglucagon derivatives and incretin mimetics. While GLP-2 acts primarily as an enterotrophic growth factor, its sister peptide GLP-1 principally modulates glucose-dependent insulin secretion and central satiety mechanisms. Dual-receptor investigations often evaluate GLP-2 alongside GIP and broader glucagon-family compounds to assess synergistic metabolic responses.

Unlike general metabolic regulators, GLP-2 exhibits highly targeted activity within the intestinal subepithelial compartment. The table below outlines key structural and functional distinctions across related proglucagon-derived and gut-derived research peptides examined in comparative peptide research:

| Compound | Amino Acid Count | Target Receptor | Primary Preclinical Research Focus | | :--- | :--- | :--- | :--- | | **GLP-2** | 33 AA | GLP-2R (GPCR) | Intestinal villus growth, mucosal barrier integrity, hexose transport | | **GLP-1** | 30 or 31 AA | GLP-1R (GPCR) | Pancreatic beta-cell insulin secretion, gastric emptying delay | | **GIP** | 42 AA | GIPR (GPCR) | Adipose lipid accumulation, glucose-dependent insulinotropic polypeptide signaling | | **Oxyntomodulin** | 37 AA | GLP-1R / GCGR | Dual agonism, energy expenditure, hepatic lipid oxidation |

Analytical Verification: RP-HPLC, Mass Spectrometry, and COA Standards

When purchasing raw peptides for controlled laboratory environments, analytical verification is necessary to guarantee data reproducibility. PX1 Research subjects every batch of GLP-2 to independent, third-party laboratory testing via an ISO 17025 accredited facility. Each shipment is backed by a lot-specific Certificate of Analysis (COA) containing comprehensive characterization data.

Chemical purity is quantified using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC), ensuring a purity threshold of ≥98%. Molecular weight and peptide sequence fidelity are validated using Electrospray Ionization Mass Spectrometry (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF). Researchers can review sample analytical reports directly in our dedicated research documentation hub to inspect chromatograms and mass spectra before integrating reagents into experimental protocols.

Endotoxin Control and Facility Manufacturing Compliance

In vitro cell culture models and delicate tissue assays are exceptionally sensitive to lipopolysaccharide (LPS) contamination. Presence of trace endotoxins can artifactually trigger Toll-like receptor 4 (TLR4) cascades, skewing cytokine expression profiles and obscuring GLP-2R specific pathways. Consequently, laboratory peptides must adhere to rigorous purity thresholds beyond basic chemical composition.

PX1 Research enforces strict endotoxin screening via Chromogenic Reagent Limulus Amebocyte Lysate (LAL) testing, guaranteeing endotoxin levels below <0.01 EU/mg. All synthesis takes place in USA-based, GMP-compliant facilities operating under ISO 9001:2015 quality standards. Solid-phase peptide synthesis (SPPS) parameters, resin linkers, and trifluoroacetic acid (TFA) cleavage steps are meticulously controlled to limit residual solvents and truncated peptide fragments.

Reconstitution, Solubility, and Storage Protocols for Laboratory Use

Proper reconstitution of lyophilized GLP-2 is vital to prevent peptide aggregation and maintain secondary structure. GLP-2 contains hydrophobic residues that may require careful solvent selection depending on final working concentrations. Detailed handling procedures and solubility characteristics are elaborated in our guide on peptide solubility and reconstitution.

For standard laboratory applications, lyophilized GLP-2 should initially be reconstituted in sterile, deionized water or dilute acetic acid (0.1% v/v) to ensure complete dissolution, followed by dilution into physiological buffers such as Phosphate-Buffered Saline (PBS, pH 7.4). Avoid high-shear vortexing; gentle inversion or room-temperature equilibration is recommended.

For short-term storage, reconstituted solutions may be kept at 4°C for up to 7 days. For long-term preservation, stock solutions must be aliquoted into polypropylene microcentrifuge tubes to prevent adsorption to glass and stored at -20°C or -80°C. Repeated freeze-thaw cycles must be strictly avoided to prevent peptide backbone hydrolysis and irreversible aggregation.

Procurement for Institutional Facilities and Wholesale Lab Accounts

Academic institutions, contract research organizations (CROs), and pharmaceutical discovery teams require stable, scalable supply chains. PX1 Research supports institutional procurement through flexible volume tiers and custom lot reservations. We maintain dedicated domestic inventory to guarantee immediate dispatch and consistent lot-to-lot continuity across multi-phase experimental trials.

Orders are processed with same-day dispatch (Monday through Friday) originating directly from our distribution hubs in California and Arizona. Organizations seeking consistent supply lines for recurring high-throughput screening assays can establish a wholesale lab account to access dedicated account management, bulk pricing, and reserved single-lot synthesis batches.