Clinical Ll-37 Peptide Provider

High-purity LL-37 host defense peptide requires rigorous analytical verification, lot-specific Certificate of Analysis documentation, and strict endotoxin quantification to ensure valid in vitro and preclinical research outcomes. PX1 Research supplies research-grade LL-37 synthesized in US-based facilities to support laboratory investigation into antimicrobial mechanisms, immunomodulation, and cellular dynamics.

GMP-compliant U.S. facilities
ISO 17025 third-party COAs
100% domestic — no imports
Fast tracked domestic shipping
Shop research peptides

Quick answer

High-purity LL-37 host defense peptide requires rigorous analytical verification, lot-specific Certificate of Analysis documentation, and strict endotoxin quantification to ensure valid in vitro and preclinical research outcomes. PX1 Research supplies research-grade LL-37 synthesized in US-based facilities to support laboratory investigation into antimicrobial mechanisms, immunomodulation, and cellular dynamics.

Reviewed by PX1 Research scientific team

Key takeaways

  • A qualified clinical [LL-37](/research-peptides/ll-37) peptide provider delivers research-grade human cathelicidin (LL-37) supported by lot-specific reverse-phase high-performance liquid chromatography (RP-HPLC) purity analysis (>98%), electrospray ionization mass spectrometry (ESI-MS) sequence verification, and quantitative [endotoxin testing](/research-peptides/endotoxin-testing-research-peptides-explained).
  • [LL-37](/research-peptides/ll-37) is the sole human representative of the cathelicidin family of host defense peptides.
  • Preclinical literature documents multiple mechanisms through which [LL-37](/research-peptides/ll-37) interacts with biological systems.
  • Verifying the purity and identity of synthesized [LL-37](/research-peptides/ll-37) is critical for maintaining experimental validity.

Defining a Qualified Clinical LL-37 Peptide Provider

A qualified clinical LL-37 peptide provider delivers research-grade human cathelicidin (LL-37) supported by lot-specific reverse-phase high-performance liquid chromatography (RP-HPLC) purity analysis (>98%), electrospray ionization mass spectrometry (ESI-MS) sequence verification, and quantitative endotoxin testing. These analytical standards ensure reproducibility in preclinical host-defense, anti-biofilm, and immunomodulatory research protocols.

When sourcing high-purity peptides for controlled laboratory environments, researchers must distinguish between generic chemical distributors and dedicated analytical suppliers. Obtaining high-grade compounds such as the LL-37 research peptide requires complete transparency regarding sequence identity, net peptide content, counterion presence, and sterility parameters. Institutional buyers evaluating the catalog of research peptides at PX1 Research gain access to comprehensive analytical dossiers designed to satisfy rigorous peer-review and experimental validation standards.

Structural and Biochemical Characteristics of LL-37

LL-37 is the sole human representative of the cathelicidin family of host defense peptides. Structurally, it consists of a 37-amino acid sequence ([LL-37, 37 aa]) characterized by a highly conserved amphipathic alpha-helical conformation in membrane-mimicking environments. With a molecular mass of approximately 4493.3 Da, the peptide exhibits a net positive charge (+6 at physiological pH) due to an abundance of basic lysine and arginine residues.

This cationic, amphipathic architecture enables LL-37 to interact directly with negatively charged bacterial membranes, lipopolysaccharides (LPS), and anionic host cell membrane components. In liquid chromatography assays, high-purity LL-37 demonstrates distinct retention profiles dependent on secondary structure folding, making precise peptide analytical testing essential prior to introducing the compound into cellular assays or biochemical binding studies.

Preclinical Mechanisms and Signaling Pathways

Preclinical literature documents multiple mechanisms through which LL-37 interacts with biological systems. The peptide serves as a functional ligand for Formyl Peptide Receptor-Like 1 (FPR2/ALX), a G-protein-coupled receptor involved in cell migration and inflammatory signaling. In vitro data indicate that LL-37 binding to FPR2/ALX stimulates intracellular calcium mobilization and activates extracellular signal-regulated kinase (ERK1/2) pathways in endothelial and epithelial cell lines.

Beyond direct receptor engagement, animal studies suggest that LL-37 modulates Toll-like receptor (TLR) signaling. By binding directly to bacterial endotoxins, LL-37 inhibits LPS-induced TLR4 activation, attenuating downstream NF-κB transcription and pro-inflammatory cytokine expression. Conversely, in specific cell types, LL-37 can complex with self-DNA or RNA to activate endosomal TLR7, TLR8, and TLR9, demonstrating a dual regulatory role dependent on microenvironmental context. Researchers investigating these complex signaling networks can explore broader antimicrobial peptide mechanisms across structural classes.

Quality Verification: RP-HPLC, Mass Spectrometry, and Endotoxin Standards

Verifying the purity and identity of synthesized LL-37 is critical for maintaining experimental validity. Minor synthetic impurities—such as truncation sequences or unremoved protecting groups—can alter amphipathic helix formation and artificially modify cellular responses. PX1 Research enforces strict quality assurance protocols for every lot, conducting RP-HPLC to confirm a purity threshold of ≥98% and ESI-MS to confirm correct molecular weight.

Endotoxin contamination represents a major confounding variable in immune peptide research. Because LL-37 interacts directly with LPS and TLR signaling pathways, unaccounted background endotoxins can completely distort baseline cytokine expression and assay readings. PX1 Research subjects all research-grade peptides to quantitative Limulus Amebocyte Lysate (LAL) testing, verifying endotoxin limits (<0.01 EU/mg) to prevent artifacts in sensitive cell culture models.

Reconstitution, Handling, and Storage Protocols for Laboratory Use

Proper handling and storage are necessary to maintain the physical stability and tertiary conformation of LL-37. Upon receipt, lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated environment protected from light. Under these conditions, the lyophilized peptide remains stable for extended periods without significant degradation or aggregation.

For laboratory reconstitution, researchers should consult standard peptide reconstitution guidelines. LL-37 should ideally be dissolved in sterile, deionized molecular biology-grade water or dilute acetic acid (0.1% v/v) to prevent early aggregation before diluting into working assay buffers. Avoid vigorous vortexing; gentle inversion or brief sonication is recommended. Reconstituted stock solutions should be aliquoted into low-binding microcentrifuge tubes and stored at -80°C to minimize repeated freeze-thaw cycles.

Comparative Analysis: Host Defense and Regenerative Research Peptides

In cell biology and tissue modeling research, LL-37 is frequently evaluated alongside other regulatory and host defense peptides. While LL-37 operates primarily via amphipathic membrane interaction and FPR2/ALX signaling, peptides such as KPV peptide target α-MSH receptors to regulate nuclear factor-kappa B activation without direct bactericidal activity. Concurrently, signaling molecules like Thymosin Alpha-1 function through distinct T-cell and dendritic cell pathways, and cytoprotective compounds like BPC-157 influence angiogenic pathways independently of primary host defense cascades. Selecting the appropriate compound depends on whether the experimental focus centers on direct membrane disruption, immune receptor modulation, or matrix remodeling.

Comparing these distinct mechanisms highlights the importance of using pure, single-component peptides. Cross-reactivity or structural variance across different supplier lots can obscure subtle mechanistic differences between cathelicidins and synthetic immunomodulators.

In Vitro Assay Applications: Anti-Biofilm and Cell Migration Models

In vitro models widely utilize LL-37 to investigate biofilm disruption and cellular re-epithelialization. Bacterial biofilm assays demonstrate that sub-inhibitory concentrations of LL-37 suppress gene expression involved in surface attachment and quorum sensing in both Gram-positive and Gram-negative species. Researchers quantify these effects through crystal violet staining, confocal laser scanning microscopy, and microfluidic flow cell systems.

In scratch wound assays and transwell migration experiments, LL-37 promotes keratinocyte and endothelial cell motility via FPR2/ALX and epidermal growth factor receptor (EGFR) transactivation. High-purity LL-37 ensures that observed migratory responses stem specifically from peptide-mediated signaling rather than trace contaminants or serum artifacts.

US Manufacturing and Laboratory Supply Logistics

Reliable laboratory supply chains require predictable shipping schedules, transparent lot tracking, and consistent domestic manufacturing. PX1 Research operates state-of-the-art facilities located in California and Arizona, providing rapid fulfillment across the United States. All orders placed Monday through Friday ship same-day, mitigating experimental delays caused by extended transit times.

By maintaining strict oversight over US-based synthesis and ISO 17025 accredited analytical testing, PX1 Research provides institutional laboratories and academic centers with consistent batch-to-batch quality. Principal investigators and lab managers seeking bulk quantities or tailored supply arrangements can establish dedicated wholesale lab accounts for streamlined procurement.

Frequently Asked Questions

What is the primary utility of LL-37 in laboratory research?

LL-37 is supplied as a research-grade compound exclusively for in vitro and preclinical laboratory investigation. It is widely studied in models evaluating host defense mechanisms, anti-biofilm activity, lipopolysaccharide neutralization, FPR2/ALX receptor signaling, and epithelial cell migration.

How does PX1 Research verify the purity of LL-37?

PX1 Research verifies every lot of LL-37 using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) to confirm peptide purity ≥98%, and Electrospray Ionization Mass Spectrometry (ESI-MS) to confirm exact molecular mass. Every order includes a downloadable, lot-specific Certificate of Analysis.

What are the endotoxin limits for PX1 Research LL-37?

All research-grade peptides from PX1 Research undergo quantitative Chromogenic LAL testing to ensure endotoxin levels remain below 0.01 EU/mg, minimizing background interference in sensitive cell culture and immune receptor assays.

What solvent is recommended for reconstituting lyophilized LL-37?

LL-37 is typically reconstituted in sterile, deionized molecular biology-grade water or 0.1% sterile acetic acid to ensure complete dissolution without premature aggregation. Working solutions can subsequently be diluted into physiological buffers prior to assay execution.

How should LL-37 be stored upon arrival at the facility?

Lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated state away from light. Reconstituted peptide stock solutions should be divided into single-use aliquots and maintained at -80°C to avoid repeated freeze-thaw cycles.

What is the molecular weight and net charge of human LL-37?

Human LL-37 has a molecular weight of approximately 4493.3 Da and carries a net positive charge of +6 at physiological pH due to its specific sequence of 37 amino acid residues.

Does PX1 Research offer bulk or wholesale options for institutional labs?

Yes, PX1 Research offers flexible supply arrangements for academic institutions, biotechnology companies, and contract research organizations via dedicated wholesale accounts, ensuring batch-to-batch consistency for large-scale studies.

Where does PX1 Research ship its research peptides from?

All PX1 Research products are manufactured and dispatched from logistics centers located in California and Arizona, featuring same-day shipping for orders placed Monday through Friday.

Related pages

All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.