Securing a reliable clinical LL-37 peptide provider is vital for laboratories investigating innate immunity, membrane dynamics, and microbial biofilm disruption. PX1 Research supplies high-purity, third-party tested LL-37 backed by lot-specific analytical documentation and rapid domestic fulfillment.
Securing a reliable clinical LL-37 peptide provider is vital for laboratories investigating innate immunity, membrane dynamics, and microbial biofilm disruption. PX1 Research supplies high-purity, third-party tested LL-37 backed by lot-specific analytical documentation and rapid domestic fulfillment.
When identifying a trustworthy clinical LL-37 peptide provider, biomedical researchers must evaluate suppliers based on analytical rigor, manufacturing transparency, and lot-to-lot consistency. LL-37, the primary cleavage product of human cathelicidin (hCAP18), is an amphipathic alpha-helical peptide whose functional integrity depends entirely on sequence fidelity and structural purity. Minor contaminants, truncated sequences, or residual TFA salts can alter experimental outcomes in cell culture and biochemical assays.
PX1 Research operates as a dedicated domestic source for laboratory-grade peptides, adhering to stringent quality benchmarks. Every synthesis batch undergoes comprehensive verification at an independent ISO 17025-accredited laboratory. By providing accessible certificates of analysis (COAs) containing liquid chromatography and mass spectrometry data, researchers can proceed with confidence, knowing their material meets exact specifications.
Ensuring high LL-37 purity requires advanced analytical instrumentation. Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) is utilized to determine target sequence percentage, separating the intact 37-amino-acid peptide from deletion sequences and chemical impurities. High-purity LL-37 typically exhibits an HPLC peak purity exceeding 98%, minimizing baseline noise in sensitive bioassays.
Equally critical is Electrospray Ionization Mass Spectrometry (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF), which confirms the precise molecular weight of LL-37 (approx. 4493.3 Da). Without rigorous mass verification, sequence misincorporation or side-chain modifications may go undetected, compromising downstream data in research-peptides environments.
Relying on internal vendor claims without independent verification introduces significant risk to experimental reproducibility. Sourcing LL-37 third party tested material guarantees that an unbiased laboratory has evaluated the peptide for identity, chemical purity, and residual contaminants.
Third-party testing protocols at PX1 Research encompass not only purity profiling but also bacterial endotoxin screening via Chromogenic Limulus Amebocyte Lysate (LAL) assays. Because human cathelicidin research frequently intersects with lipopolysaccharide (LPS) binding assays and inflammatory pathways, low endotoxin levels are required to avoid false positives or unintended immune receptor activation in in vitro models.
To aid procurement teams and principal investigators in evaluating peptide vendors, the following baseline standards detail the technical requirements necessary for reproducible preclinical work:
1. Purity Verification: ≥98% pure by RP-HPLC, ensuring minimal sequence truncations. 2. Molecular Weight Identity: Verified by ESI-MS/MALDI-TOF matching theoretical mass (4493.3 Da). 3. Third-Party COA: Lot-specific analytical reports accessible directly from an accredited laboratory. 4. Endotoxin Control: Tested via LAL assay to guarantee low endotoxin limits (<0.1 EU/mg). 5. Manufacturing Origin: Produced under GMP-compliant processes within USA-based facilities. 6. Order Fulfillment: LL-37 fast shipping with same-day dispatch from domestic distribution hubs in California and Arizona.
LL-37 is an endogenous host defense peptide consisting of 37 amino acids starting with two leucine residues ([LL-37, 37 aa]). In biological systems, it is cleaved from the C-terminal end of the hCAP18 pro-protein by serine proteases such as proteinase 3. Structurally, LL-37 adopts a predominantly random coil conformation in aqueous solution at low ionic strength but transitions into a rigid amphipathic alpha-helix upon interacting with phospholipid membranes or in the presence of physiological salt concentrations.
Preclinical studies suggest that this alpha-helical structure allows LL-37 to electrostatically bind negatively charged bacterial membrane components, such as phosphatidylglycerol and lipopolysaccharides. The hydrophobic face of the helix subsequently inserts into the lipid bilayer, destabilizing membrane integrity through toroidal pore formation or non-specific detergent-like disruption models.
In vitro models widely utilize LL-37 to investigate bacterial membrane permeabilization, anti-biofilm dynamics, and host immunomodulation. Research indicates that LL-37 can inhibit the initial attachment of Gram-positive and Gram-negative bacteria to abiotic surfaces, as well as downregulate genes responsible for biofilm matrix production at sub-inhibitory concentrations.
Furthermore, animal models and cell culture studies explore LL-37 within simulated wound environments. Researchers examine its interactions with keratinocytes, endothelial cells, and fibroblasts, focusing on receptor mediated pathways such as Formyl Peptide Receptor-Like 1 (FPRL1/FPR2) and EGFR transactivation. These studies provide valuable data regarding cellular migration, angiogenesis signaling, and re-epithelialization dynamics.
When structuring comparative assays, investigators often evaluate LL-37 alongside other bioactive peptides operating across host defense, tissue repair, and inflammatory signaling pathways. For instance, while LL-37 acts as a direct amphipathic host defense peptide, Thymosin Alpha-1 is studied primarily for its regulatory effects on T-cell maturation and innate cytokine responses.
Similarly, research exploring tissue repair mechanisms may compare the epithelial signaling of LL-37 against gastric-derived repair compounds like BPC-157 or tripeptide anti-inflammatory models like KPV. Understanding the distinct receptor targets and kinetic profiles of these distinct compounds helps laboratories design focused multi-peptide experimental panels.
Proper reconstitution and storage are necessary to maintain the physical state of LL-37 over extended experimental timelines. Lyophilized peptide should be stored at -20°C or -80°C in a desiccated environment upon arrival. Prior to opening vial caps, allow the container to equilibrate to room temperature to prevent atmospheric moisture condensation inside the vial.
For reconstitution, solubilize the peptide in sterile, deionized water or diluted acetic acid (0.1%) to establish a stable stock solution before diluting into working buffers such as PBS or cell culture media. Because LL-37 exhibits a propensity to aggregate at high salt concentrations or stick to glass and plastic surfaces, researchers frequently utilize low-binding polypropylene tubes. Aliquoting working solutions avoids repeated freeze-thaw cycles, preserving peptide activity for downstream assays.
Uninterrupted supply chains are vital for maintaining continuous research schedules. Recognizing this need, PX1 Research offers LL-37 fast shipping options with same-day dispatch for orders placed before daily cutoff times Monday through Friday. Products are fulfilled directly from state-of-the-art facilities located in California and Arizona.
Lyophilized peptides are packaged in temperature-monitored, secure packaging designed to withstand environmental fluctuations during transit. Institutional buyers and university laboratories seeking large-scale quantities or ongoing routine delivery can access dedicated services via our wholesale account portal.
How do I select a reliable clinical LL-37 peptide provider for institutional research?
A qualified provider should offer US-manufactured peptides, clear lot-to-lot traceability, independent ISO 17025 third-party COAs featuring HPLC and MS data, low endotoxin levels, and fast, secure shipping protocols.
What options exist for LL-37 fast shipping to prevent laboratory downtime?
PX1 Research provides fast shipping on LL-37, including same-day dispatch for orders placed Monday through Friday before cutoff times, shipped directly from fulfillment centers in CA and AZ.
What analytical benchmarks define verified LL-37 purity?
High-purity LL-37 is defined by an RP-HPLC purity score of ≥98%, along with mass spectrometry (ESI-MS or MALDI-TOF) confirming the correct molecular mass of 4493.3 Da.
Why is ordering LL-37 third party tested material critical for bioassay accuracy?
Third-party testing verifies sequence identity, confirms high chemical purity, and ensures bacterial endotoxin levels remain below stringent thresholds, preventing confounding variables in cell culture and innate immunity models.
What is the primary biological classification and structural motif of LL-37?
LL-37 is the 37-amino-acid C-terminal peptide cleaved from human cathelicidin (hCAP18). It adopts an amphipathic alpha-helical conformation upon binding to membrane lipids or in physiological salt solutions.
How is LL-37 evaluated in biofilm disruption assays?
In vitro studies evaluate LL-37 for its ability to prevent initial bacterial adherence to surfaces and disrupt established microbial biofilms by interfering with quorum sensing and extracellular matrix structural stability.
What are the recommended laboratory storage conditions for lyophilized LL-37?
Lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated container away from light. Reconstituted aliquots should be frozen to prevent degradation and avoid repeated freeze-thaw cycles.
How should LL-37 be reconstituted for in vitro cell culture studies?
It is typically reconstituted in sterile water or dilute acetic acid (0.1%) using low-binding polypropylene tubes, then diluted into culture media or buffer solutions immediately prior to experiment execution.
Does PX1 Research offer bulk or institutional account pricing?
Yes, university departments, CROs, and industrial research facilities can request bulk quantities and specialized pricing structures through the PX1 Research wholesale portal.
Is LL-37 approved for human administration or clinical therapy?
No. All products supplied by PX1 Research, including LL-37, are strictly for laboratory research use only and are not intended for human consumption, clinical diagnosis, or therapeutic application.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.