Looking for GLP 2 peptide for sale for institutional or academic laboratory research? PX1 Research provides USA-manufactured, highly purified Glucagon-Like Peptide-2 (GLP-2) with verified HPLC purity, mass spectrometry sequence confirmation, and lot-specific Certificates of Analysis for in vitro and preclinical investigation.
Looking for GLP 2 peptide for sale for institutional or academic laboratory research? PX1 Research provides USA-manufactured, highly purified Glucagon-Like Peptide-2 (GLP-2) with verified HPLC purity, mass spectrometry sequence confirmation, and lot-specific Certificates of Analysis for in vitro and preclinical investigation.
Glucagon-Like Peptide-2 (GLP-2) is a 33-amino acid proglucagon-derived peptide co-secreted alongside GLP-1 from enteroendocrine L-cells in the distal gut in response to nutrient ingestion. While its sister peptide GLP-1 primarily governs glucose homeostasis and insulin secretion, GLP-2 functions predominantly as an intestinal trophic hormone. Researchers examining gastrointestinal physiology, epithelial barrier repair, and enterocyte proliferation utilize GLP-2 to map G-protein coupled receptor signaling networks within the intestinal mucosa.
When procurement officers and principal investigators search for a reliable supplier offering GLP 2 peptide for sale, analytical verification and lot consistency are paramount. Research-grade GLP-2 provided by PX1 Research is synthesized under strict quality management protocols, ensuring that sequence integrity and peptide content meet exact specifications for cell culture models, tissue explants, and preclinical rodent studies. All materials are supplied strictly for laboratory research use only.
Endogenous GLP-2 possesses the amino acid sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD. In biological systems, the N-terminal Ala2 residue is subject to rapid cleavage by the serine protease dipeptidyl peptidase IV (DPP-IV), yielding the inactive metabolite GLP-2(3-33). Consequently, preclinical research paradigms often investigate both native GLP-2 and DPP-IV-resistant analogs to evaluate receptor binding kinetics and downstream signal transduction.
GLP-2 acts via the GLP-2 receptor (GLP-2R), a class B G-protein coupled receptor expressed primarily in subepithelial myofibroblasts, enteric neurons, and specific enteroendocrine cells. Receptor activation stimulates intracellular cyclic adenosine monophosphate (cAMP) accumulation and activates protein kinase A (PKA) pathways. This indirect signaling cascade triggers the downstream release of secondary mediators such as insulin-like growth factor 1 (IGF-1) and keratinocyte growth factor (KGF), which subsequently drive crypt cell proliferation and suppress enterocyte apoptosis. Researchers exploring these pathways can access complementary materials across our research library hub and complete all-peptides catalog.
Preclinical literature demonstrates that GLP-2 administration in animal models induces marked morphometric changes in the small and large intestines. In rodent assays, exogenous GLP-2 administration correlates with increased mucosal wet weight, elevated villus height, and enhanced crypt cell mitotic activity. These trophic effects have made GLP-2 a primary focus in preclinical models of short bowel syndrome (SBS), enteritis, and intestinal ischemia-reperfusion injury.
Furthermore, in vitro cell monolayer studies (e.g., Caco-2 and HT-29 models) indicate that GLP-2 signaling modulates tight junction proteins, including zonula occludens-1 (ZO-1) and occludin. Preclinical findings suggest that GLP-2 signaling reduces mucosal permeability, decreases systemic bacterial translocation, and upregulates nutrient transporters such as SGLT-1 and GLUT2. Investigating these tissue repair mechanisms provides crucial data regarding mucosal recovery following chemical or ischemic damage.
Understanding the specialized role of GLP-2 requires evaluating its position within the broader proglucagon and incretin peptide families. While sharing a genetic origin with GLP-1, GLP-2 exhibits minimal metabolic influence on pancreatic insulin secretion, operating instead as a targeted gastrointestinal growth factor. Laboratories often run side-by-side comparative assays to differentiate between metabolic signaling and mucosal trophic responses.
For instance, researchers comparing metabolic regulators with gut-trophic peptides frequently analyze GLP-1 receptor agonists alongside GIP research compounds to evaluate pancreatic versus extra-pancreatic receptor distribution. Additionally, synthetic analogs such as Teduglutide, a DPP-IV resistant GLP-2 derivative featuring a Gly2 substitution, are frequently studied in tandem with native GLP-2 to assess extended receptor activation profiles and half-life extension kinetics in preclinical settings.
When evaluating a supplier providing GLP 2 peptide for sale, academic and industrial researchers require absolute transparency regarding chemical composition. Impurities, residual trifluoroacetate (TFA) salts, and bacterial endotoxins can confound cell culture assays and distort receptor binding assays. PX1 Research enforces rigorous quality assurance standards to guarantee consistent experimental parameters.
Every lot of PX1 Research GLP-2 undergoes comprehensive testing via an independent ISO 17025 accredited laboratory. Sequence accuracy and molecular weight are confirmed using Electrospray Ionization Mass Spectrometry (ESI-MS), while peptide purity is verified by High-Performance Liquid Chromatography (RP-HPLC) to exceed 98%. Furthermore, every batch is subjected to Chromogenic LAL assay testing to verify that bacterial endotoxin levels remain below strictly monitored research thresholds.
GLP-2 is supplied as a sterile, lyophilized cake or powder to maximize long-term peptide stability. For optimal recovery and experimental reproducibility, researchers should adhere to standard aseptic reconstitution practices inside a certified biosafety cabinet.
1. **Centrifugation:** Prior to opening the vial, centrifuge the product at 2,000 x g for 30–60 seconds to ensure all lyophilized powder consolidates at the bottom of the container. 2. **Solvent Selection:** Reconstitute GLP-2 using sterile bacteriostatic water, sterile nuclease-free water, or buffered saline (PBS, pH 7.4), depending on the requirements of your specific assay. 3. **Dissolution:** Gently add the solvent along the inner glass wall of the vial. Allow the peptide to hydrate naturally for several minutes, then gently swirl the vial. Avoid vigorous vortexing, which can introduce shear stress and induce peptide aggregation. 4. **Concentration & Aliquoting:** Reconstitute to a stock concentration appropriate for downstream serial dilutions. Prepare single-use aliquots using low-protein-binding polypropylene microcentrifuge tubes to prevent adsorption loss during freeze-thaw cycles.
Lyophilized GLP-2 peptide should be stored at -20°C or -80°C in a desiccated environment away from direct light, where it remains stable for up to 24 months. Avoid storing lyophilized peptides in frost-free freezers, as temperature fluctuations during automatic defrost cycles accelerate chemical degradation.
Once reconstituted into solution, working aliquots should be used immediately or stored at -80°C for short-term experimental series. Repeated freeze-thaw cycles must be strictly avoided, as repeated phase transitions promote peptide dimerization and precipitation, which compromise assay quantitative accuracy.
Procuring high-grade GLP-2 for academic institutions, biotechnology firms, and contract research organizations (CROs) requires a supply chain optimized for speed and reliability. PX1 Research manufactures all research peptides within GMP-compliant facilities located in the United States, facilitating stringent batch tracking and immediate inventory availability.
For large-scale screening projects or continuous long-term studies, research organizations can take advantage of specialized lab account and bulk procurement programs. Orders placed Monday through Friday ship same-day from domestic fulfillment centers in California and Arizona, ensuring minimal transit times and cold-chain integrity upon delivery.
What is the primary research application of GLP-2 peptide?
GLP-2 is primarily studied in preclinical and in vitro research focused on intestinal epithelial growth, enterocyte proliferation, tight junction regulation, mucosal barrier integrity, and gastrointestinal nutrient transport mechanisms.
How is the purity of PX1 Research GLP-2 verified?
Every lot of GLP-2 undergoes third-party analytical testing at an ISO 17025 accredited laboratory. Purity (>98%) is confirmed via Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC), and molecular mass is verified using Mass Spectrometry (MS). Certificate of Analysis (COA) documents are available per lot.
What are the endotoxin specifications for GLP-2?
PX1 Research performs LAL (Limulus Amebocyte Lysate) endotoxin testing on all peptide lots to ensure endotoxin levels meet strict research thresholds, preventing non-specific inflammatory responses in cell culture and preclinical assays.
How should lyophilized GLP-2 be stored upon receipt?
Lyophilized GLP-2 should be stored at -20°C or -80°C in a dry environment. Desiccation prevents moisture absorption, ensuring long-term stability for up to 24 months.
What solvent is recommended for reconstituting GLP-2?
GLP-2 is typically reconstituted in sterile water for injection, bacteriostatic water, or phosphate-buffered saline (PBS, pH 7.4), depending on the specific requirements of the in vitro assay or animal model.
What is the difference between native GLP-2 and synthetic analogs like Teduglutide?
Native GLP-2 contains an Alanine at position 2, making it susceptible to rapid cleavage by DPP-IV enzymes. Analogs such as Teduglutide feature an amino acid substitution (Gly2) designed to resist DPP-IV degradation, altering enzymatic half-life in preclinical studies.
Can GLP-2 peptide be purchased for human administration?
No. All GLP-2 products provided by PX1 Research are sold strictly for in vitro laboratory research and preclinical animal experimentation. They are not for human consumption, medical treatment, or clinical use.
Where does PX1 Research ship GLP-2 orders from?
All materials are synthesized, tested, and shipped directly from domestic fulfillment facilities in California and Arizona. Orders placed Monday through Friday before cut-off ship same-day.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.