Glucagon-Like Peptide-2 (GLP-2) research peptides are widely utilized in preclinical biochemical research to investigate enterocyte proliferation, intestinal barrier integrity, and nutrient absorption pathways. PX1 Research supplies high-purity, US-manufactured GLP-2 sequences verified by independent mass spectrometry and HPLC analysis strictly for laboratory evaluation.
Glucagon-Like Peptide-2 (GLP-2) research peptides are widely utilized in preclinical biochemical research to investigate enterocyte proliferation, intestinal barrier integrity, and nutrient absorption pathways. PX1 Research supplies high-purity, US-manufactured GLP-2 sequences verified by independent mass spectrometry and HPLC analysis strictly for laboratory evaluation.
GLP-2 research peptides are synthetic 33-amino acid peptide sequences modeled after endogenous glucagon-like peptide-2, a hormone co-secreted by enteroendocrine L-cells in the distal intestine. Evaluated extensively in preclinical models, GLP-2 serves as a primary candidate for investigating intestinal crypt cell mitosis, mucosal repair mechanisms, and enteric vascular blood flow in laboratory environments.
When acquiring GLP-2 research peptides for laboratory use, investigators require precise chemical synthesis and high purity to avoid artifactual signaling in cellular assays. Endogenous GLP-2 is rapidly cleaved by the enzyme dipeptidyl peptidase-IV (DPP-IV) at the Alanine-2 residue; consequently, researchers frequently utilize native GLP-2 alongside DPP-IV resistant analogs to quantify degradation kinetics and receptor occupancy in vitro.
All GLP-2 formulations provided by PX1 Research are synthesized under rigorous quality controls, intended solely for in vitro experimentation and animal model studies. They are explicitly not for clinical, diagnostic, or therapeutic use in humans or animals.
Endogenous GLP-2 is generated via post-translational processing of the proglucagon precursor protein by prohormone convertase 1/3 (PC1/3) within intestinal L-cells and central nervous system neurons. The primary sequence of human GLP-2 is Hadgsftsdysimldnlaardfinwlitqitdkkknd, comprising a 33-amino acid single-chain polypeptide with a conserved N-terminal region critical for target activation.
In cell-free and cell-based assays, binding occurs specifically at the GLP-2 Receptor (GLP-2R), a Class B G-protein-coupled receptor (GPCR). Receptor activation stimulates adenylate cyclase, leading to intracellular cyclic AMP (cAMP) accumulation and downstream activation of Protein Kinase A (PKA). Because GLP-2R expression is predominantly localized to enteric neurons, subepithelial myofibroblasts, and endocrine cells rather than directly on enterocytes, preclinical studies demonstrate that GLP-2 exerts its trophic actions indirectly via paracrine mediators, including Insulin-like Growth Factor-1 (IGF-1) and ErbB receptor ligands.
For investigators exploring the broader signaling cascade of proglucagon-derived peptides, reviewing our peptides research database provides comprehensive documentation on precursor cleavage pathways and GPCR binding dynamics.
In vitro and animal model studies have illuminated several primary pathways modulated by GLP-2 research peptides. Preclinical literature indicates that GLP-2 administration in rodent models leads to measurable increases in intestinal weight, villus height, and crypt cell proliferation while simultaneously inhibiting enterocyte apoptosis.
Key downstream pathways documented in laboratory models include:
1. Upregulation of IGF-1 expression within subepithelial myofibroblasts, driving mucosal growth. 2. Enhancement of intestinal barrier function via increased expression of tight junction proteins such as occludin and claudin-1. 3. Augmentation of brush-border enzyme activity (e.g., maltase, sucrase) and hexose transporter upregulation (GLUT2 and SGLT1). 4. Modulation of mesenteric arterial blood flow to optimize nutrient absorption dynamics.
Researchers evaluating mucosal injury models—such as chemotherapy-induced mucositis or ischemic tissue damage—frequently employ gut peptide mechanisms to dissect the temporal relationship between GLP-2 signaling and mucosal restitution.
Understanding the functional distinction between GLP-2 and related proglucagon-derived sequences is essential for proper experimental design. While derived from the same prohormone precursor, GLP-2 exhibits distinct receptor specificity and physiological target tissues compared to GLP-1 and GIP.
In preclinical bioassays, GLP-1 receptor agonists primarily engage pancreatic beta-cell receptors to stimulate glucose-dependent insulin secretion and slow gastric emptying. Conversely, GLP-2 exhibits minimal affinity for the GLP-1 receptor, exerting its actions predominantly on the gastrointestinal mucosa. Similarly, dual or triple incretin agonists like tirzepatide research sequences focus on metabolic homeostasis and glycemic control. Researchers seeking a comprehensive overview of enteric signaling analogs can browse our complete catalog of research peptides to select target-specific compounds for comparative binding studies.
To preserve structural stability and prevent non-specific adsorption to plasticware, strict handling protocols must be followed when working with lyophilized GLP-2 research peptides. Lyophilized cakes should be allowed to equilibrate to room temperature inside a desiccator before opening to prevent moisture condensation.
For initial reconstitution, standard laboratory practices recommend dissolving GLP-2 in sterile, bacteriostatic, or deionized water, depending on assay requirements. If solubility challenges occur due to hydrophobic residue clustering, neutral buffer systems such as Phosphate-Buffered Saline (PBS, pH 7.4) may be utilized. For cellular assays requiring low protein binding, adding a carrier protein such as 0.1% Bovine Serum Albumin (BSA) reduces surface adherence.
Once reconstituted, working aliquots should be stored at -20°C or -80°C to avoid repeated freeze-thaw cycles, which induce peptide degradation and aggregation. Avoid vigorous vortexing; gentle inversion or mild swirling is recommended to achieve complete dissolution.
Experimental reproducibility in peptide research depends strictly on sequence fidelity and chemical purity. Impurities such as truncated sequences, deletion peptides, or residual trifluoroacetic acid (TFA) salts can yield false-positive or inhibitory results in enzyme and receptor assays.
At PX1 Research, every lot of GLP-2 peptide undergoes rigorous analytical testing in ISO 17025 accredited facilities. Purity is established using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC), ensuring a minimum purity threshold of 98%. Molecular weight and sequence identity are confirmed via Electrospray Ionization Mass Spectrometry (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF).
Additionally, because endotoxins can activate TLR4 pathways in cell cultures and confound physiological measurements, PX1 Research conducts chromogenic Limulus Amebocyte Lysate (LAL) testing to ensure endotoxin levels remain strictly controlled below standard laboratory thresholds. Certificate of Analysis (COA) documentation detailing HPLC chromatograms and MS spectra is fully traceable by lot number.
Lyophilized GLP-2 research peptides exhibit high chemical stability when stored under appropriate thermal and environmental conditions. Unopened vials should be stored at -20°C for short-term projects or -80°C for long-term storage, protected from light exposure.
Desiccated storage prevents atmospheric moisture uptake, which can initiate hydrolytic cleavage of peptide bonds over time. Reconstituted stock solutions typically maintain stability at 2°C to 8°C for up to 7 days, provided sterile handling procedures are maintained. For extended experimental timelines, freezing liquid aliquots at -80°C is strongly advised. Researchers scaling up experimental protocols can explore options for bulk research inquiries to obtain uniform batch lots.
Reliable research outcomes require transparent sourcing and verified domestic manufacturing standards. PX1 Research manufactures all GLP-2 peptides within US-based, GMP-compliant facilities, mitigating risks associated with international supply chain disruptions, unverified imports, and batch-to-batch variability.
By enforcing strict lot traceability, transparent third-party analytical verification, and rapid same-day shipping from California and Arizona distribution hubs, PX1 Research provides academic and institutional laboratories with the chemical precision necessary for advanced preclinical investigation.
What is the sequence and molecular weight of GLP-2 research peptide?
GLP-2 is a 33-amino acid peptide sequence with the primary sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD. Its calculated molecular weight is approximately 3766.1 Da. Exact mass determination for each production lot is verified via mass spectrometry and reported on the product COA.
What receptor targets does GLP-2 engage in laboratory assays?
GLP-2 selectively targets the GLP-2 Receptor (GLP-2R), a G-protein-coupled receptor located primarily on subepithelial myofibroblasts, enteric neurons, and enteroendocrine cells. It exhibits low cross-reactivity with the GLP-1 receptor or glucagon receptor.
How is GLP-2 peptide purity verified at PX1 Research?
Purity is verified using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) coupled with Mass Spectrometry (MS). Each lot must meet or exceed a 98% purity standard, with full chromatograms provided on the Certificate of Analysis.
What reconstitution solvent is recommended for GLP-2?
GLP-2 is typically reconstituted in sterile laboratory water or phosphate-buffered saline (PBS, pH 7.4). For in vitro cell assays sensitive to surface adsorption, adding 0.1% BSA or standard cell culture media can prevent peptide loss on plastic containers.
Are GLP-2 research peptides endotoxin tested?
Yes. PX1 Research performs chromogenic LAL endotoxin testing on all peptide lots to ensure compatibility with sensitive cellular assays and animal models.
How should reconstituted GLP-2 be stored?
Reconstituted GLP-2 liquid stock should be divided into single-use working aliquots and stored at -20°C or -80°C to minimize degradation from freeze-thaw cycles. Short-term storage at 2–8°C is acceptable for up to 7 days.
How does GLP-2 differ functionally from GLP-1 in preclinical models?
While GLP-1 primarily regulates glucose homeostasis, insulin secretion, and gastric motility via GLP-1R, GLP-2 primarily regulates mucosal crypt cell proliferation, intestinal growth, and enterocyte integrity via GLP-2R.
Can GLP-2 research peptides be ordered in bulk for large-scale institutional studies?
Yes. PX1 Research offers institutional supply and custom batch synthesis for large-scale preclinical trials. Inquiries can be submitted directly through our wholesale program.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.