LL-37 Lab Tested

Overview of LL-37 as a Primary Human Cathelicidin Peptide

LL-37 is the sole cleavage product of the human cathelicidin antimicrobial protein hCAP18. Synthesized primarily by neutrophils, macrophages, epithelial cells, and keratinocytes, this 37-amino-acid amphipathic alpha-helical peptide serves as a primary effector molecule in innate mucosal and systemic defense mechanisms. In cell-free and in vitro assays, researchers investigate LL-37 for its capacity to disrupt lipid bilayers, modulate host receptor activity, and clear complex extracellular matrices.

Because antimicrobial and membrane-active peptides are prone to aggregation, degradation, and non-specific binding during synthesis, utilizing an LL-37 lab tested batch is critical for obtaining reproducible empirical data. Researchers requiring high-purity peptides for cell culture or structural biophysics can explore the complete PX1 Research catalog to support standardized experimental designs.

Analytical Rigor: Verification Criteria for LL-37 Lab Tested Material

Evaluating synthesized peptides for advanced research requires rigorous quality control protocols. High-performance liquid chromatography (HPLC) and mass spectrometry (MS) are the benchmark analytical tools used to confirm that LL-37 reaches a purity threshold of ≥98%. Without rigorous validation, baseline peptide impurities such as truncated sequences, counter-ion residues, or residual organic solvents can confound cell viability assays and receptor-binding dynamics.

To maintain valid experimental controls, every batch of PX1 Research material undergoes strict testing protocols at domestic ISO 17025 accredited laboratories. The primary quality criteria verified prior to release include:

- **Purity Verification by RP-HPLC:** High-Resolution Reversed-Phase HPLC confirms sequence purity and detects trace diastereomers or failure sequences. - **Mass Spectrometry (ESI-MS / MALDI-TOF):** Verifies the exact molecular weight (4493.3 Da expected theoretical mass) to ensure correct primary sequence synthesis. - **Endotoxin Testing (LAL Assay):** Quantifies lipopolysaccharide contamination to ensure suitability for endotoxin-sensitive cell culture and innate immunity models. - **Counter-Ion Determination & Residual Solvent Analysis:** Ensures complete removal of trifluoroacetic acid (TFA) down to negligible laboratory-safe levels. - **Lot Traceability & Storage Standards:** Full lot isolation paired with analytical records ensuring consistent performance across multi-phase studies.

Investigative teams purchasing through wholesale lab accounts gain access to lot-specific documentation that validates these parameters prior to assay integration.

Interpreting an LL-37 COA HPLC and Mass Spectrometry Report

A authentic Certificate of Analysis (COA) provides quantitative evidence of chemical purity and structural identity. When reviewing an LL-37 COA HPLC document, researchers should look for a sharp, isolated main peak on the chromatogram, confirming the absence of closely eluting deletion peptides or oxidation products. The integration area of the main peak relative to total peak area dictates the reported purity percentage.

Electrospray Ionization Mass Spectrometry (ESI-MS) further validates that the target peptide possesses the correct monoisotopic mass. Because LL-37 contains multiple basic residues (lysine and arginine), mass spectra typically display multi-charged species ([M+4H]4+, [M+5H]5+, [M+6H]6+). Calculating the deconvoluted mass from these charge states must yield the theoretical molecular mass of 4493.3 g/mol. Detailed analytical frameworks and spectrum interpretation notes are available in the PX1 Research library.

Structural Dynamics and Biophysical Mechanism of Action

LL-37 adopts an unstructured random coil conformation in dilute aqueous solutions, but transitions into an amphipathic alpha-helix upon interacting with hydrophobic environments, lipid membranes, or trifluoroethanol (TFE). Its sequence ([LL-37, 37 aa]) exhibits a distinct segregation of positively charged arginine/lysine residues on one face and hydrophobic leucine/phenylalanine residues on the other.

Biophysical studies demonstrate that this amphipathic arrangement allows LL-37 to insert into negatively charged phospholipid membranes, such as those found on bacterial surfaces. The mechanism of membrane insertion follows a carpet-like model, where peptide accumulation parallel to the membrane surface induces curvature stress, pore formation, and eventual membrane solubilization. Additional details regarding cationic host-defense peptides can be reviewed in our section on antimicrobial peptide mechanisms.

Microbial Membrane and Biofilm Disruption Research

Preclinical in vitro assays investigate LL-37 for its capacity to prevent biofilm formation and destabilize pre-existing microbial extracellular polymeric substances (EPS). Unlike conventional small-molecule antibiotics that target specific metabolic enzymes, LL-37 exerts physical destabilization on bacterial envelopes, rendering resistance development less frequent in preclinical models.

In vitro models demonstrate that sub-inhibitory concentrations of LL-37 downregulate bacterial genes responsible for flagellar assembly and quorum sensing. This attenuates surface attachment and initial microcolony development. Researchers investigating multi-drug resistant strains utilize laboratory-grade LL-37 to benchmark biofilm dissolution rates against novel synthetic cathelicidin mimetics.

LL-37 in Wound-Environment and Innate-Immunity In Vitro Assays

Beyond direct membrane interactions, LL-37 functions as a signaling molecule within preclinical wound-environment models. In vitro studies show that LL-37 binds to Formyl Peptide Receptor 2 (FPR2/ALX) and Epidermal Growth Factor Receptor (EGFR), triggering downstream MAPK/ERK kinase cascades. These pathways modulate keratinocyte migration, endothelial cell proliferation, and capillary-like tube formation.

In cell culture environments modeling cutaneous repair, LL-37 regulates the expression of matrix metalloproteinases (MMPs) and chemoattracts immune cells to clearance sites. Because these signaling pathways are highly sensitive to endotoxin contamination, assays evaluating tissue remodeling require LL-37 lab tested compounds with certified low-endotoxin thresholds.

Comparative Analysis: LL-37 and Related Research Compounds

When designing innate-immunity or tissue-repair models, researchers frequently compare LL-37 with other regulatory host-defense and tissue-modulating peptides. While LL-37 primary acts as a cationic amphipathic membrane disruptor and FPR2 agonist, compounds like BPC-157 target gastrointestinal and musculoskeletal repair pathways via distinct angiogenic and focal-adhesion dynamics. Similarly, TB-500 acts predominantly through actin-monomer sequestration and cell-migration pathways rather than direct antimicrobial membrane interactions.

Understanding these mechanistic distinctions allows comparative researchers to select the optimal peptide target. For example, while BPC-157 research models focus heavily on tendon-to-bone junction recovery, LL-37 is selected primarily for studies intersecting bacterial clearance with epithelial cell signaling.

Laboratory Reconstitution Protocol and Solubility Dynamics

Lyophilized LL-37 is supplied as a trifluoroacetate or acetate salt. Achieving proper solubilization without peptide aggregation requires strict adherence to laboratory protocols. LL-37 dissolves readily in sterile, deionized laboratory water or low-ionic-strength aqueous buffers (such as 10 mM sodium phosphate, pH 6.5–7.2).

To reconstitute LL-37 for cell culture or biophysical assays:

1. Equilibrate the vial of lyophilized peptide to room temperature inside a laminar flow hood before opening to prevent condensation. 2. Add sterile target solvent (e.g., sterile water for injection or low-salt buffer) directly to the vial wall. 3. Allow the solvent to hydrate the cake for 2–3 minutes, then gently swirl the vial. **Do not vortex vigorously**, as shear stress can induce peptide aggregation. 4. If necessary for cell culture experiments, dilute stock solutions into culture media immediately prior to application.

Consult the PX1 Research peptide handling guide for specific buffer compatibility tables and ionic-strength recommendations.

Storage, Stability, and Handling Guidelines for Lyophilized LL-37

Lyophilized LL-37 exhibits long-term stability when stored at -20°C or -80°C in a desiccated container away from light. Subjecting the dry powder to repeated freeze-thaw cycles or ambient humidity will accelerate peptide degradation via hydrolysis or methionine oxidation.

Reconstituted stock solutions stored at 4°C are stable for short-term use (up to 7 days). For long-term storage of liquid aliquots, store at -80°C in polypropylene tubes to minimize peptide adsorption to glass surfaces. Avoid repeated freeze-thaw cycles of liquid solutions. Detailed stability parameters are published alongside each LL-37 lab tested batch.

Sourcing Verification: Sourcing High-Purity Research Peptides

Reliable empirical results depend directly on supplier transparency and manufacturing standards. PX1 Research synthesizes all compounds in domestic, GMP-compliant facilities within the United States. Every lot undergoes independent analytical testing at ISO 17025 accredited laboratories to confirm sequence fidelity, purity, and freedom from endotoxins.

All orders ship directly from centralized fulfillment facilities located in California and Arizona, with same-day dispatch available Monday through Friday for orders placed prior to daily cutoff times. Academic institutions, biotechnology firms, and contract research organizations can access bulk purchasing options via our wholesale portal.