Ll-37 Lab Tested

What Does 'LL-37 Lab Tested' Mean in Peptide Research?

In biomedical research, the designation 'lab tested' indicates that a chemical compound has undergone rigorous, multi-tiered analytical evaluation to confirm its structural identity, purity percentage, and microbiological cleanliness before use in laboratory assays. For a complex 37-amino-acid peptide like LL-37, comprehensive lab testing is critical to ensure experimental reproducibility and eliminate confounding factors introduced by truncated sequences, residual reagents, or heavy metal contamination.

When purchasing compounds for cellular or molecular research, evaluating ll-37 lab tested documentation requires examining lot-specific Certificates of Analysis (COAs). A complete analytical validation package includes Reversed-Phase High-Performance Liquid Chromatography (RP-HPLC) chromatograms to quantify purity, Electrospray Ionization Mass Spectrometry (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF) spectral output to verify exact molecular weight, and Chromogenic Recombinant Factor C (rFC) or LAL assays to measure bacterial endotoxin concentrations.

Molecular Structure and Chemical Profile of LL-37

LL-37 is the sole amphipathic alpha-helical peptide belonging to the cathelicidin family found in humans. Derived via proteolytic cleavage from the C-terminal region of the hCAP18 precursor protein by proteinase 3, the peptide consists of 37 amino acid residues beginning with two leucine residues (LL): LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. With a net positive charge of +6 at physiological pH, its structural motif consists of a distinct hydrophobic face and a hydrophilic cationic face.

This specific amphipathic structure allows LL-37 to interact electrostatically with negatively charged phospholipid bilayers, such as bacterial cell membranes. In structural biology literature, researchers utilize high-resolution Nuclear Magnetic Resonance (NMR) spectroscopy and circular dichroism (CD) to observe how LL-37 transitions from a random coil in aqueous solution into an alpha-helical conformation when exposed to membrane-mimicking environments or liposomes.

Preclinical Mechanisms of Action Investigated In Vitro

Preclinical studies suggest that LL-37 exerts biological activity through multiple distinct pathways, making it a primary subject of investigation across microbiology, immunology, and tissue regeneration research hubs. In vitro assays demonstrate that the peptide's primary mechanism involves membrane disruption via the 'toroidal pore' or 'carpet' model, wherein cationic residues bind to bacterial lipopolysaccharide (LPS) or teichoic acids, causing localized membrane depolarization and cell lysis.

Beyond direct membrane interaction, in vitro data indicate that LL-37 acts as a chemotactic agent for immune cells by binding to the Formyl Peptide Receptor-Like 1 (FPRL1/FPR2). Researchers studying inflammatory signaling cascades observe that LL-37 can modulate cytokine expression, neutralize extracellular LPS to attenuate TLR4 receptor activation, and stimulate endothelial cell proliferation in vascular tube formation assays. Exploring these pathways helps catalog how research peptides influence host defense mechanisms.

Analytical Purity Standards: RP-HPLC, Mass Spectrometry, and Endotoxin Limits

Because synthetic peptide synthesis relies on step-by-wise Solid-Phase Peptide Synthesis (SPPS), incomplete coupling reactions can produce deletion sequences that closely resemble the target peptide. Standard analytical protocols dictate that high-grade LL-37 must achieve a purity threshold of ≥98% as measured by RP-HPLC. The chromatogram must display a single sharp, symmetrical peak, with integrated peak area analysis showing minimal background noise or side-product accumulation.

Mass spectrometry provides the secondary tier of verification by measuring the mass-to-charge ratio (m/z). For LL-37 (theoretical monoisotopic mass of approximately 4493.3 Da), mass spec analysis verifies that the synthesized peptide matches its theoretical sequence without unwanted side-chain modifications, oxidation, or protecting group retention. Additionally, because LL-37 is frequently deployed in sensitive cell culture assays, endotoxin limits must be strictly controlled (typically <0.1 EU/mg) to prevent non-specific activation of immune signaling pathways.

Reconstitution Guidelines and Handling Protocols for Laboratory Use

Proper handling and reconstitution protocols are vital to preserving the structural integrity of LL-37 in laboratory environments. Lyophilized peptide powder should be stored in a sealed container at -20°C or -80°C to prevent moisture absorption and enzymatic degradation. Prior to opening, vials should be allowed to equilibrate to room temperature inside a desiccator cabinet to minimize condensation.

Reconstitution should be performed using sterile, deionized laboratory-grade water or dilute sterile buffers (such as 0.1% acetic acid) depending on the target solubility and assay requirements. Due to the amphipathic nature of LL-37, high concentration stock solutions should be prepared, aliquoted into single-use polypropylene tubes, and flash-frozen at -80°C to prevent multiple freeze-thaw cycles that induce peptide aggregation or surface adsorption.

Comparative Analysis: LL-37 vs. Related Research Peptides

When designing comparative assays for cell signaling, host defense, or tissue repair models, researchers frequently evaluate LL-37 alongside other specialized peptides. While LL-37 functions primarily as a cathelicidin-derived amphipathic antimicrobial and immunomodulatory peptide, alternative compounds target distinct receptors and biological cascades. For instance, KPV is a tripeptide derived from alpha-MSH investigated for its concentrated anti-inflammatory signaling, whereas Thymosin Beta-4 is studied for its actin-sequestering and cell migration properties. Similarly, GHK-Cu is evaluated in dermal matrix remodeling assays due to its copper-binding affinity. Comparing these molecules allows investigators to isolate specific cellular responses across distinct experimental frameworks.

Storage Stability, Degradation Pathways, and Shelf-Life

The chemical stability of synthesized peptides is governed by sequence composition and storage conditions. LL-37 contains several amino acid residues susceptible to chemical degradation under unfavorable conditions, including oxidation of methionine or tryptophan residues, deamidation of asparagine/glutamine, and peptide backbone hydrolysis when exposed to basic pH or elevated temperatures.

To maintain analytical purity over extended research timelines, lyophilized LL-37 must be stored desiccated at -20°C or below, where it typically exhibits stability for up to 24 months. Once reconstituted, aqueous solutions should be stored at 4°C for no more than 24 to 48 hours, or stored at -80°C for short-term stock preservation. Utilizing low-binding microcentrifuge tubes minimizes loss due to hydrophobic interaction with container walls.

Institutional Sourcing & Quality Control Requirements

Academic laboratories, biotech facilities, and institutional procurement departments require reliable suppliers capable of providing fully traceable, verified compounds. PX1 Research manufactures research compounds in GMP-compliant, USA-based facilities, subjecting every production batch to independent testing at ISO 17025 accredited analytical laboratories. This ensures that every lot of LL-37 delivered meets strict physical and chemical specifications.

Principal investigators and laboratory managers setting up recurring research pipelines can request full analytical packages—including raw HPLC chromatograms and mass spectral reports—prior to purchasing. For large-scale studies requiring consistent batch identity, dedicated wholesale accounts provide bulk procurement capabilities with guaranteed lot continuity and rapid, temperature-controlled shipping directly from facilities in California and Arizona.