Ll-37 Test Report
A rigorous LL-37 test report provides essential analytical proof of sequence integrity, purity, and freedom from biological contaminants. For biomedical researchers conducting in vitro and preclinical assays, understanding how to interpret HPLC chromatograms, mass spectra, and endotoxin reports is critical for experimental reproducibility.
Quick answer
A rigorous LL-37 test report provides essential analytical proof of sequence integrity, purity, and freedom from biological contaminants. For biomedical researchers conducting in vitro and preclinical assays, understanding how to interpret HPLC chromatograms, mass spectra, and endotoxin reports is critical for experimental reproducibility.
Key takeaways
- An [LL-37](/research-peptides/ll-37) test report is an analytical [Certificate of Analysis](/research-peptides/what-is-a-coa-for-peptides) (COA) documenting the chemical identity, purity, and safety profile of the 37-amino-acid human cathelicidin peptide.
- [LL-37](/research-peptides/ll-37) is an amphipathic, alpha-helical peptide derived from the C-terminus of the human cathelicidin antimicrobial protein CAP18.
- Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) serves as the industry gold standard for assessing the chemical purity of synthetic peptides.
- Because host defense peptides like [LL-37](/research-peptides/ll-37) interact directly with cell surface receptors—including Formyl Peptide Receptor 2 (FPR2) and Toll-like Receptor 4 (TLR4) pathways in cellular models—endotoxin contamination presents a major confounding variable in experimental data.
Definitive Overview: What Is an LL-37 Test Report?
An LL-37 test report is an analytical Certificate of Analysis (COA) documenting the chemical identity, purity, and safety profile of the 37-amino-acid human cathelicidin peptide. It verifies sequence accuracy via mass spectrometry (4493.3 Da expected mass), quantifies purity exceeding 98% using RP-HPLC, and confirms sub-threshold endotoxin levels (<0.01 EU/µg) via chromogenic LAL testing for rigorous in vitro research.
When purchasing compounds for laboratory investigations, evaluating an authentic LL-37 test report ensures that experimental observations stem directly from the target peptide rather than synthesis side-products, truncated sequences, or bacterial lipopolysaccharide (LPS) contamination.
Chemical Structure and Mass Spectrometry (MS) Verification
LL-37 is an amphipathic, alpha-helical peptide derived from the C-terminus of the human cathelicidin antimicrobial protein CAP18. Composed of 37 amino acids with the primary sequence [LL-37, 37 aa], it possesses a net positive charge of +6 at physiological pH and a theoretical monoisotopic molecular mass of approximately 4493.33 Da.
In a standard LL-37 test report, mass spectrometry—typically Electrospray Ionization Time-of-Flight (ESI-TOF) or Matrix-Assisted Laser Desorption/Ionization (MALDI-TOF)—is utilized to confirm molecular weight. The resulting mass spectrum must exhibit a predominant mass peak corresponding to the observed [M+H]+ or multi-charged states (such as [M+4H]4+ or [M+5H]5+) matching the theoretical mass within a strict tolerance window (typically ±1.0 Da). Mass spectrometry eliminates ambiguity regarding amino acid deletions, incomplete coupling steps during solid-phase peptide synthesis (SPPS), or incorrect counter-ion calculations.
RP-HPLC Chromatographic Purity Quantification
Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) serves as the industry gold standard for assessing the chemical purity of synthetic peptides. In the evaluation of LL-37, liquid chromatography separates the primary full-length peptide from synthesis impurities, such as beta-alanine insertion products, racemized enantiomers, or truncated sequence fragments.
A compliant LL-37 test report provides a complete HPLC chromatogram demonstrating a sharp, symmetrical single peak under UV detection (typically at 214 nm or 220 nm, corresponding to peptide bond absorption). Peak area integration must confirm a relative area percentage of ≥98.0%. Key chromatographic parameters specified on a thorough report include column dimensions (e.g., C18 4.6 × 250 mm, 5 µm particle size), mobile phase gradients (Water/Acetonitrile containing 0.1% Trifluoroacetic Acid), flow rate (1.0 mL/min), and column temperature settings.
Endotoxin Testing and Biological Contaminant Limits
Because host defense peptides like LL-37 interact directly with cell surface receptors—including Formyl Peptide Receptor 2 (FPR2) and Toll-like Receptor 4 (TLR4) pathways in cellular models—endotoxin contamination presents a major confounding variable in experimental data. Bacterial lipopolysaccharide (LPS) can trigger potent immunomodulatory cascades independent of the peptide's true intrinsic activity.
A rigorous LL-37 test report includes quantitative endotoxin testing performed via the Limulus Amebocyte Lysate (LAL) chromogenic assay. Research-grade compounds provided by PX1 Research are held to stringent standards, maintaining endotoxin levels strictly below 0.01 EU/µg. Verifying sub-threshold endotoxin levels is essential when conducting microglial activation assays, macrophage differentiation studies, or downstream cytokine expression profiles available in our preclinical research library.
Evaluating Physical Characteristics: Solubility and Counter-Ion Analysis
Beyond MS and HPLC analysis, a complete analytical documentation package evaluates physical appearance and moisture content. Synthetic LL-37 is supplied as a lyophilized white to off-white cake or powder. The lyophilization process removes residual organic solvents (such as dimethylformamide or piperidine) utilized during solid-phase synthesis.
Additionally, solid-phase peptide synthesis yields peptides bound to trifluoroacetate (TFA) counter-ions. High levels of residual TFA can exhibit cytotoxicity in sensitive primary cell lines. High-tier laboratory suppliers conduct counter-ion content verification or salt exchange processes (yielding acetate or hydrochloride salts) when required for sensitive cell culture assays. Researchers reviewing our complete antimicrobial peptides catalog can inspect batch-specific solubility profiles in sterile water or buffered saline.
Comparative Analysis: LL-37 vs. Other Host Defense Research Peptides
In preclinical literature, LL-37 is frequently evaluated alongside other mammalian host defense peptides to compare membrane interaction kinetics, lipopolysaccharide neutralization efficiency, and chemotactic signaling pathways. Understanding structural variations among these analogs assists investigators in selecting the appropriate peptide model.
For instance, investigators frequently compare human LL-37 with the murine cathelicidin CRAMP, which shares structural homology but exhibits distinct charge distributions and altered binding affinities in rodent models. Similarly, researchers contrast cathelicidin mechanisms against beta-sheet defensins such as human beta-defensin-2 or tissue-regenerative peptides like BPC-157 and TB-500. Selecting fully characterized compounds across these classes ensures high fidelity in comparative assays across our antimicrobial peptide research hub.
Preclinical Applications and Mechanisms Documented in Literature
Preclinical in vitro and animal studies indicate that LL-37 exhibits multifunctional biological roles beyond simple direct membrane disruption. In cell culture models, LL-37 forms amphipathic alpha-helices upon contacting phospholipid membranes, leading to toroidal pore formation or carpet-like membrane destabilization in prokaryotic membrane models.
In vitro assays demonstrate that LL-37 modulates innate immune responses by binding directly to extracellular LPS, thereby inhibiting LPS-induced activation of TLR4 complex pathways in monocytes. Furthermore, animal models suggest that LL-37 influences cell migration, angiogenesis, and re-epithelialization via FPR2 receptor transactivation. All documented effects reported in scientific literature derive strictly from controlled laboratory models utilizing high-purity, batch-verified material.
Reconstitution, Handling, and Storage Protocols for Laboratory Use
Proper handling and reconstitution procedures are vital to preserve the physical stability and tertiary amphipathic alpha-helical conformation of LL-37. Upon receiving a batch-verified sample accompanied by a valid LL-37 test report, laboratory personnel should observe strict sterile reconstitution guidelines.
To reconstitute lyophilized LL-37, briefly centrifuge the vial prior to opening to consolidate the powder at the bottom. Reconstitute in sterile, nuclease-free research water or phosphate-buffered saline (PBS, pH 7.4) to a stock concentration of 1 mg/mL. Avoid vigorous vortexing, which can induce peptide aggregation; gently swirl or invert the container. Aliquot reconstituted stock solutions into polypropylene microcentrifuge tubes to prevent adsorption loss to glass surfaces, and store aliquots at -80°C to maintain stability over extended research timelines.
PX1 Research Sourcing and Quality Assurance Standards
PX1 Research maintains an uncompromising commitment to analytical rigor, supplying research-grade peptides exclusively manufactured in state-of-the-art US-based facilities operating under GMP-compliant protocols. Every production lot undergoes independent, third-party laboratory verification within ISO 17025 accredited testing environments.
Investigative facilities establishing wholesale peptide accounts receive comprehensive, lot-traceable COA documentation with every shipment. Orders placed Monday through Friday ship same-day from our dual logistics hubs in California and Arizona, ensuring rapid temperature-controlled delivery for critical laboratory workflows.
Frequently Asked Questions
What critical parameters should I look for on an LL-37 test report?
A valid LL-37 test report must present a clear RP-HPLC chromatogram showing ≥98% purity, ESI-MS mass verification confirming the expected molecular weight of ~4493.3 Da, an endotoxin assay result strictly below 0.01 EU/µg, lot number, date of testing, and third-party laboratory verification.
Why is mass spectrometry (MS) essential for LL-37 verification?
Mass spectrometry confirms the correct amino acid sequence length and elemental composition. Because LL-37 consists of 37 amino acids, MS ensures that truncated peptides or deletion sequences generated during solid-phase synthesis are identified and excluded.
How does high endotoxin content affect LL-37 cell culture research?
Endotoxins (LPS) bind to cell surface receptors like TLR4, inducing inflammatory pathways independently of LL-37. Unwanted endotoxin contamination skews cytokine release data and cell activation assays, invalidating experimental controls.
What solvent is recommended for reconstituting research-grade LL-37?
LL-37 reconstitutes effectively in sterile, nuclease-free water or standard PBS (pH 7.4). For long-term stock stability, prepare concentrated aliquots in low-binding polypropylene tubes and freeze at -80°C to prevent surface adsorption and freeze-thaw degradation.
What is the physical appearance of high-purity LL-37 upon delivery?
Pure LL-37 is supplied as a lyophilized, off-white to white cake or powder. It should be stored at -20°C or -80°C upon arrival in a dry environment protected from light.
Where are PX1 Research peptides synthesized and tested?
All PX1 Research compounds are manufactured in US-based, GMP-compliant facilities and tested in ISO 17025 accredited analytical laboratories utilizing RP-HPLC, mass spectrometry, and chromogenic LAL assays.
How does LL-37 structurally differ from murine CRAMP?
While both are cathelicidin-derived antimicrobial peptides, human LL-37 and murine CRAMP share structural homology but possess distinct amino acid sequences and charge densities, which alter receptor binding kinetics in species-specific preclinical models.
Are PX1 Research compounds suitable for clinical or veterinary administration?
No. All products provided by PX1 Research are strictly intended for laboratory research use only (RUO), including in vitro cellular assays and non-human preclinical models. They are never intended for human or clinical consumption.
Related pages
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.