Navigating peptide procurement for advanced innate immunity research requires rigorous validation. Sourcing LL-37 that has undergone independent third-party analytical testing ensures batch identity, chemical purity, and low endotoxin thresholds essential for reproducible cell culture and preclinical assays.
Navigating peptide procurement for advanced innate immunity research requires rigorous validation. Sourcing LL-37 that has undergone independent third-party analytical testing ensures batch identity, chemical purity, and low endotoxin thresholds essential for reproducible cell culture and preclinical assays.
A third-party tested LL-37 research peptide is a synthetic 37-amino-acid cathelicidin sequence independently verified by an ISO 17025 accredited laboratory using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) and Electrospray Ionization Mass Spectrometry (ESI-MS). Testing confirms peptide purity exceeding 98%, exact molecular mass (4493.3 Da), and low endotoxin levels (<0.1 EU/mg) for reliable in vitro research.
When procuring compounds for biochemical assays, researchers must confirm that the analytical documents provided are lot-specific and executed by independent testing facilities rather than internal manufacturer metrics. High-purity LL-37 peptide maintains structural integrity in aqueous buffer environments, ensuring that observed cellular responses in membrane disruption or signaling assays stem strictly from the target sequence rather than synthesis truncations or counter-ion contaminants.
LL-37 is the sole amphipathic alpha-helical peptide of the cathelicidin family identified in humans. Cleaved proteolytically from the C-terminus of the hCAP18 precursor protein by proteinase 3, LL-37 consists of the sequence [LL-37, 37 aa] With a net positive charge of +6 at physiological pH, its structural motif consists of a distinct hydrophobic face and a positively charged hydrophilic face.
This amphipathic conformation allows LL-37 to interact dynamically with lipid bilayers. In laboratory settings, researchers investigate how LL-37 shifts from a flexible, unstructured state in pure water to an organized alpha-helical secondary structure upon encountering anionic lipid membranes or physiological salt concentrations. Understanding these structural dynamics requires absolute sample purity, as truncated peptide fragments missing terminal basic residues (such as Lysine or Arginine) exhibit altered charge densities and compromised helical folding.
Researchers exploring host defense mechanisms frequently index LL-37 within broader studies of amphipathic peptides. Accessing complete chemical profiles via our research library hub allows investigators to cross-reference structural data with historical assays across diverse cationic peptide classes.
In vitro and preclinical research models primarily focus on the electrostatic interactions between LL-37 and bacterial cell membranes. Because bacterial outer membranes contain high concentrations of negatively charged phospholipids (such as phosphatidylglycerol and cardiolipin), the positively charged residues of LL-37 aggregate on the membrane surface.
Preclinical studies suggest that upon reaching a critical concentration, LL-37 transitions into an amphipathic helix that embeds into the lipid bilayer. Investigators utilize fluorescence spectroscopy, oriented circular dichroism, and solid-state NMR to determine whether membrane destabilization occurs via a toroidal pore mechanism, a carpet-like detergent effect, or non-lytic transient permeability.
In addition to direct membrane dynamics, LL-37 serves as a key molecule in modulating immune receptor signaling models. In cell-free and cell-based assays, LL-37 has been observed binding to extracellular nucleic acids, neutral lipopolysaccharides (LPS), and specific cell-surface receptors like FPR2 (Formyl Peptide Receptor 2), altering down-stream kinase cascades without causing immediate membrane lysis.
Beyond planktonic bacterial membrane studies, LL-37 is heavily investigated in biofilm models. Biofilms present a complex extracellular polymeric substance (EPS) matrix that protects sessile bacterial communities. In vitro research models demonstrate that sub-inhibitory concentrations of LL-37 can suppress biofilm formation by downregulating genes involved in bacterial motility (such as flagellar assembly) and quorum sensing.
In 3D tissue-culture and cellular wound-scratch assays, LL-37 is evaluated for its role in cellular migration and re-epithelialization dynamics. Researchers study how LL-37 stimulates epidermal growth factor receptor (EGFR) transactivation and promotes keratinocyte migration. These models help delineate how native host defense peptides regulate localized tissue remodeling environments.
Because these assays often involve sensitive primary cells, even trace amounts of manufacturing impurities or residual trifluoroacetic acid (TFA) can mask real peptide activity or induce artifactual cytotoxicity. Thus, obtaining fully verified compounds from our all peptides catalog ensures experimental fidelity.
To guarantee that LL-37 performs predictably in empirical assays, analytical verification via dual-method chromatography and spectrometry is mandatory. Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) separates the primary 37-amino-acid peptide from synthesis byproducts, such as deletion sequences, capped truncations, and oxidized side-chains.
A valid RP-HPLC chromatogram displays a single, sharp principal peak with a retention time matching the reference standard. The relative area under the curve (AUC) quantifies the chemical purity percentage. For research-grade LL-37, a purity threshold of ≥98% is established to prevent non-target peptides from competing for membrane-binding sites.
Electrospray Ionization Mass Spectrometry (ESI-MS) complements HPLC by confirming molecular mass. The theoretical monoisotopic mass of synthetic LL-37 (C105H257N35O42) is verified through observed charge states (m/z ratios such as [M+4H]4+, [M+5H]5+, and [M+6H]6+). Together, HPLC and ESI-MS establish that the sequence is intact and devoid of major deletion contaminants.
Synthetic peptides are routinely generated via Solid-Phase Peptide Synthesis (SPPS). However, post-synthesis processing, water purification loops, and handling can introduce bacterial endotoxins (lipopolysaccharides). For an innate immunity peptide like LL-37—which directly binds LPS—uncontrolled background endotoxin levels render immunological assays uninterpretable.
Independent third-party testing employs the Chromogenic Limulus Amebocyte Lysate (LAL) assay or Recombinant Factor C (rFC) assay to quantify endotoxin concentration. Research-grade LL-37 intended for delicate cell culture or receptor binding studies must maintain endotoxin levels below 0.1 EU/mg.
High endotoxin contamination causes false-positive activation of Toll-like Receptor 4 (TLR4) pathways in macrophage and dendritic cell models. By specifying low-endotoxin, third-party verified lots, investigators ensure that observed cytokine release profiles (such as IL-8 or TNF-alpha modulation) are attributable to LL-37 activity rather than background bacterial debris.
A authentic Certificate of Analysis (COA) provides complete transparency regarding product quality. When evaluating an LL-37 COA, laboratory managers should verify five key structural metrics:
1. **Independent Laboratory Header:** The document must originate from an accredited, independent third-party analytical lab (such as an ISO 17025 certified facility), featuring clear contact details and verification signatures. 2. **Lot Number Traceability:** The lot number printed on the vial must match the COA exactly to ensure batch-level accountability. 3. **Purity Percentage (RP-HPLC):** The chromatogram trace must be included, demonstrating ≥98% purity without hidden shoulder peaks. 4. **Mass Verification (ESI-MS):** The mass spectrum must confirm the target molecular weight (4493.3 Da) within standard mass tolerance windows. 5. **Endotoxin Level:** Quantitative LAL assay results listed in EU/mg or EU/vial.
PX1 Research maintains rigorous quality protocols. Every single lot undergoes independent testing, ensuring that researchers receive fully validated materials for high-throughput screening and biophysical characterization.
When designing host defense or cellular signaling experiments, researchers frequently compare LL-37 against other regulatory or protective peptides. Understanding structural and functional differences allows laboratories to select appropriate positive or negative controls.
For instance, while LL-37 functions primarily as a cationic, amphipathic host defense peptide focused on membrane dynamics and initial innate responses, compounds like Thymosin Alpha-1 operate predominantly via adaptive immune modulation and T-cell differentiation pathways. Conversely, tissue repair and cellular migration models often contrast LL-37 with TB-500 (a synthetic fragment of Thymosin Beta-4) or BPC-157, which influence actin polymerization and angiogenic signaling cascades respectively.
Below is a comparison of key physical and functional parameters across commonly studied research peptides:
To maintain the chemical stability of synthetic LL-37, proper laboratory handling and storage protocols must be maintained. Lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated environment away from light. Under these conditions, the dry peptide remains stable for extended periods.
Reconstitution protocols require careful attention to the hydrophobic nature of amphipathic peptides. Lyophilized LL-37 should first be dissolved in sterile, endotoxin-free water or dilute acetic acid (0.1%) to prevent aggregation before diluting into physiological buffers like Phosphate-Buffered Saline (PBS) or cell culture media. Direct reconstitution into high-salt buffers can induce immediate self-association or precipitation.
Once reconstituted, stock solutions should be aliquoted into polypropylene microcentrifuge tubes to prevent adsorption to glass surfaces. Avoid repeated freeze-thaw cycles, as physical shear forces can cause peptide denaturation or aggregation. Reconstituted aliquots should be kept at -80°C for long-term storage or used within 24–48 hours if maintained at 4°C.
PX1 Research is committed to supplying high-tier research peptides manufactured exclusively in USA-based facilities adhering to cGMP-compliant standards. Recognizing the critical nature of baseline data reproducibility, we enforce non-negotiable quality control metrics for every catalog item.
Every batch of LL-37 is submitted to an independent ISO 17025 accredited testing laboratory. We provide publicly accessible, batch-specific COAs detailing full RP-HPLC chromatograms, ESI-MS spectrums, and quantitative LAL endotoxin testing. For institutional procurement departments interested in larger quantities or ongoing supply agreements, explore our wholesale account portal for bulk laboratory sourcing options.
What is the primary function of LL-37 in research models?
LL-37 is studied primarily as an amphipathic host defense peptide in models evaluating microbial membrane disruption, biofilm suppression, cell migration, and innate immune receptor modulation.
Why is third-party testing critical for LL-37 research peptides?
Third-party testing verifies sequence identity, confirms high chemical purity (≥98% via RP-HPLC), checks theoretical mass (via ESI-MS), and ensures low endotoxin levels (<0.1 EU/mg), preventing confounding variables in cell culture and biochemical assays.
What testing methods are used to verify LL-37 purity and mass?
Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) is used to verify peptide purity and detect truncations, while Electrospray Ionization Mass Spectrometry (ESI-MS) confirms the exact molecular weight (4493.3 Da).
What are acceptable endotoxin limits for LL-37 in cell culture assays?
For sensitive cell culture and immune signaling research, endotoxin levels should ideally be below 0.1 EU/mg as measured by a quantitative LAL assay to avoid unintended TLR4 activation.
How should lyophilized LL-37 be stored upon arrival?
Lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated container protected from light to maintain long-term stability.
What solvent is recommended for reconstituting LL-37?
Reconstitution is typically initiated using sterile, endotoxin-free water or 0.1% dilute acetic acid to ensure complete dissolution prior to secondary dilution into buffered solutions like PBS.
Is LL-37 stable after multiple freeze-thaw cycles?
No. Repeated freeze-thaw cycles can promote peptide aggregation and precipitation. Stock solutions should be divided into single-use aliquots and stored at -80°C.
Are PX1 Research peptides manufactured in the USA?
Yes. All PX1 Research peptides are manufactured in USA-based facilities under strict quality controls and independently verified by third-party ISO 17025 accredited laboratories.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.