A lot-specific LL-37 Certificate of Analysis (COA) is essential for validating the purity, identity, and chemical integrity of cathelicidin research compounds before initiating in vitro or animal studies. PX1 Research delivers full analytical transparency with every batch through rigorous third-party testing.
A lot-specific LL-37 Certificate of Analysis (COA) is essential for validating the purity, identity, and chemical integrity of cathelicidin research compounds before initiating in vitro or animal studies. PX1 Research delivers full analytical transparency with every batch through rigorous third-party testing.
An LL-37 Certificate of Analysis (COA) is an official analytical document verifying the identity, purity, and safety profile of a specific lot of the cathelicidin peptide LL-37. It confirms sequence integrity via mass spectrometry, purity levels above 98% through RP-HPLC, and minimal endotoxin contamination using LAL testing for rigorous laboratory research.
When purchasing compounds for laboratory experimentation, relying on supplier self-reporting without independent verification introduces significant risk to assay reproducibility. A comprehensive COA serves as a quality guarantee, documenting that the physical sample matches its stated chemical structure and meets established benchmarks for baseline analytical purity. Researchers can explore PX1 Research's full catalog of research peptides to access verifiable analytical documentation across all host-defense and signaling sequences.
Evaluating an LL-37 COA requires understanding the key testing methodologies used to profile synthetic peptides. The primary analytical tool is Reversed-Phase High-Performance Liquid Chromatography (RP-HPLC). RP-HPLC separates the target 37-amino-acid peptide sequence from synthesis truncation products, deleted sequences, and side-chain modified impurities. High-grade research reagents must exhibit a single sharp peak on the HPLC chromatogram, representing a purity threshold of 98.0% or higher.
Mass Spectrometry (MS)—typically utilizing Electrospray Ionization (ESI-MS) or Matrix-Assisted Laser Desorption/Ionization Time-of-Flight (MALDI-TOF)—confirms peptide identity by calculating the exact molecular weight. Human cathelicidin LL-37 has a theoretical molecular weight of approximately 4493.3 Da. Match between theoretical mass and experimental mass spectra confirms correct primary amino acid assembly without unexpected post-translational modifications or incorrect protecting group retention.
Equally vital is the Limulus Amebocyte Lysate (LAL) assay for endotoxin quantification. Because synthetic peptides can harbor bacterial endotoxins (lipopolysaccharides or LPS) from manufacturing equipment or water sources, quantifying endotoxin units per milligram (EU/mg) is crucial. High endotoxin content can inadvertently activate Toll-like receptors (TLR4) in cell cultures, completely obscuring the genuine biological effects of the LL-37 research peptide.
LL-37 is the sole human representative of the cathelicidin family of host-defense peptides. Structurally, it consists of a 37-residue sequence starting with two leucine residues ([LL-37, 37 aa]). In physiological and laboratory buffers, it adopts an amphipathic alpha-helical conformation, positioning hydrophobic residues on one face and positively charged basic residues (lysines and arginines) on the opposing face.
Preclinical studies suggest that this amphipathic structure allows LL-37 to interact directly with anionic lipid membranes, such as those found on bacterial cell walls or fungal membranes. In vitro assays demonstrate that LL-37 disrupts membrane potential through pore formation or detergent-like carpet mechanisms. Additionally, animal models show that LL-37 interacts with formyl peptide receptor 2 (FPR2) and purinergic receptors (P2X7) to modulate cell migration, cytokine release, and tissue remodeling cascades.
To better contextualize how host-defense molecules operate across cellular pathways, investigators frequently reference the PX1 research library for detailed mechanism breakdowns and analytical methodologies.
In vitro models testing antimicrobial mechanisms or immune signaling are exceptionally sensitive to micro-impurities. If a sample contains 5% synthesis artifacts or residual trifluoroacetic acid (TFA) salts, cellular responses such as apoptosis, metabolic activity changes, or gene transcription shifts may reflect cytotoxicity rather than physiological LL-37 activity.
Endotoxin contamination presents an even greater hazard in immunological and cell culture research. Endotoxins at levels as low as 0.1 EU/mL can trigger massive NF-κB activation and pro-inflammatory cytokine expression in macrophage and keratinocyte cultures. If an investigator utilizes unverified LL-37 with high endotoxin contamination, the observed immune response may be entirely driven by LPS rather than the peptide itself. PX1 Research subjects all peptide lots to stringent LAL testing, ensuring endotoxin levels remain beneath strict limits for reliable cellular testing.
In host defense and tissue response research, LL-37 is frequently evaluated alongside other synthetic peptides that exhibit immunomodulatory or regenerative properties in vitro. Understanding how LL-37 compares to related compounds helps research teams design targeted experimental protocols.
For instance, the tripeptide KPV peptide, derived from alpha-MSH, acts primarily through anti-inflammatory intracellular cascades and nuclear factor kappa B (NF-κB) suppression rather than direct membrane disruption. Conversely, the copper-binding peptide GHK-Cu research peptide is primarily studied in fibroblast migration and gene regulation models rather than direct antimicrobial assays. Furthermore, investigators studying cellular recovery pathways often compare these responses against pentadecapeptide models like BPC-157. Selecting the appropriate compound depends on whether the laboratory objective targets membrane interaction, cytokine modulation, or matrix stabilization.
For broader context on how various host-defense sequences act in cellular models, consult our technical guide on antimicrobial research peptides.
PX1 Research enforces strict quality assurance protocols to guarantee that every peptide delivered meets international laboratory standards. All production occurs in GMP-compliant, USA-based synthesis facilities utilizing modern solid-phase peptide synthesis (SPPS) technology.
Following synthesis and purification, every production batch is transferred to an independent ISO 17025 accredited testing facility. Independent third-party laboratories perform high-resolution RP-HPLC and mass spectrometry analysis to generate lot-specific COAs. PX1 Research never relies on internal self-audits or generalized batch templates. Each container is assigned a unique lot number that directly corresponds to downloadable analytical reports.
For institutional laboratories requiring high-volume supplies with identical analytical profiles across multiple batches, setting up a wholesale laboratory account provides direct access to dedicated lot reservations and specialized quality control documentation.
Proper handling and storage of lyophilized peptides are vital for maintaining the structural integrity confirmed on the Certificate of Analysis. Upon receipt, lyophilized LL-37 should be stored at -20°C or -80°C in a desiccated environment to prevent atmospheric moisture absorption.
When reconstituting for laboratory use, allow the vial to equilibrate to room temperature prior to opening to minimize condensation. Reconstitute using sterile, endotoxin-free water or sterile phosphate-buffered saline (PBS, pH 7.4), depending on assay requirements. If long-term stability in liquid form is needed, researchers often utilize bacteriostatic water or add carrier proteins such as 0.1% Bovine Serum Albumin (BSA) to prevent non-specific peptide binding to plastic tubes.
Reconstituted solutions should be aliquoted into single-use working volumes and stored at -80°C to avoid repeated freeze-thaw cycles. Freeze-thaw stress can cause peptide aggregation or peptide bond cleavage, rendering the initial COA purity values invalid.
Validating your LL-37 batch documentation is a straightforward process with PX1 Research. Every peptide vial features a printed lot number on the label. Institutional researchers can cross-reference this lot number directly on our website to view and download the full PDF Certificate of Analysis.
When inspecting your document, verify that the lot number matches your vial label, the HPLC retention time aligns with a single defined peak showing >98% purity, the mass spectrum displays a primary mass peak corresponding to 4493.3 Da (±1 Da), and the LAL assay confirms acceptable low endotoxin levels. If additional analytical data or raw spectral files are required for compliance or publication records, PX1 Research provides dedicated support for laboratory personnel.
How do I interpret the HPLC chromatogram on an LL-37 Certificate of Analysis?
The HPLC chromatogram displays light absorbance over retention time. A high-purity LL-37 sample will show a single dominant peak representing the intact 37-amino-acid peptide. Small minor peaks indicate minor synthesis truncations or deletion sequences; the integrated area under the primary peak relative to total peak area yields the percentage purity (e.g., >98%).
What is the acceptable endotoxin threshold on an LL-37 COA for in vitro research?
For sensitive cell culture assays, endotoxin levels should ideally remain below 1.0 EU/mg (and often below 0.1 EU/mL in working solutions) to prevent nonspecific Toll-like receptor activation. PX1 Research provides LAL endotoxin testing on COAs to confirm suitability for cellular models.
What mass spectrometry technique is used to verify LL-37 identity?
Electrospray Ionization Mass Spectrometry (ESI-MS) or MALDI-TOF mass spectrometry is standard. The experimental mass spectrum must display molecular ion peaks matching the theoretical molecular weight of human LL-37 (~4493.3 Da).
What solvent is recommended for reconstituting LL-37 in laboratory experiments?
LL-37 is typically reconstituted in sterile, endotoxin-free water or sterile PBS (pH 7.4). For working stock solutions in cell culture, adding 0.1% BSA or dilute acetic acid can prevent adsorption to polypropylene tubes.
How long is lyophilized LL-37 stable when stored at -20°C?
Lyophilized LL-37 stored at -20°C in a desiccated container remains chemically stable for 24 months or longer. For long-term preservation exceeding two years, storage at -80°C is recommended.
Is LL-37 provided by PX1 Research suitable for human administration?
No. All compounds supplied by PX1 Research, including LL-37, are strictly for laboratory research, in vitro experimentation, and preclinical scientific studies. They are not for human or veterinary consumption, therapy, or clinical use.
Why is third-party lab testing superior to in-house manufacturer COAs?
Third-party testing conducted by an independent ISO 17025 accredited laboratory eliminates bias and conflicts of interest. It ensures that purity percentages, mass verification, and endotoxin metrics are objective and reproducible.
How does LL-37 differ structurally from other immunomodulatory research peptides?
LL-37 is a 37-amino-acid amphipathic alpha-helical peptide capable of direct membrane interaction. Smaller signaling peptides, such as the tripeptide KPV, lack membrane-disrupting helical structures and operate primarily via intracellular pathway binding.
All products are sold strictly for laboratory and research use only. Not for human or veterinary use, diagnosis, treatment or consumption. Statements have not been evaluated by the FDA.